Anti DCAF11 pAb (ATL-HPA031157)

Atlas Antibodies

SKU:
ATL-HPA031157-25
  • Immunohistochemical staining of human kidney shows moderate to strong positivity in tubular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DCAF11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410776).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DDB1 and CUL4 associated factor 11
Gene Name: DCAF11
Alternative Gene Name: GL014, PRO2389, WDR23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022214: 97%, ENSRNOG00000018825: 98%
Entrez Gene ID: 80344
Uniprot ID: Q8TEB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDG
Gene Sequence NSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDG
Gene ID - Mouse ENSMUSG00000022214
Gene ID - Rat ENSRNOG00000018825
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCAF11 pAb (ATL-HPA031157)
Datasheet Anti DCAF11 pAb (ATL-HPA031157) Datasheet (External Link)
Vendor Page Anti DCAF11 pAb (ATL-HPA031157) at Atlas Antibodies

Documents & Links for Anti DCAF11 pAb (ATL-HPA031157)
Datasheet Anti DCAF11 pAb (ATL-HPA031157) Datasheet (External Link)
Vendor Page Anti DCAF11 pAb (ATL-HPA031157)