Anti DCAF1 pAb (ATL-HPA053203)

Atlas Antibodies

Catalog No.:
ATL-HPA053203-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DDB1 and CUL4 associated factor 1
Gene Name: DCAF1
Alternative Gene Name: KIAA0800, MGC102804, VPRBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040325: 100%, ENSRNOG00000013841: 100%
Entrez Gene ID: 9730
Uniprot ID: Q9Y4B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWD
Gene Sequence IAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWD
Gene ID - Mouse ENSMUSG00000040325
Gene ID - Rat ENSRNOG00000013841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCAF1 pAb (ATL-HPA053203)
Datasheet Anti DCAF1 pAb (ATL-HPA053203) Datasheet (External Link)
Vendor Page Anti DCAF1 pAb (ATL-HPA053203) at Atlas Antibodies

Documents & Links for Anti DCAF1 pAb (ATL-HPA053203)
Datasheet Anti DCAF1 pAb (ATL-HPA053203) Datasheet (External Link)
Vendor Page Anti DCAF1 pAb (ATL-HPA053203)