Anti DCAF1 pAb (ATL-HPA053203)

Atlas Antibodies

SKU: ATL-HPA053203-25

• 
• 

Protein Description: DDB1 and CUL4 associated factor 1
Gene Name: DCAF1
Alternative Gene Name: KIAA0800, MGC102804, VPRBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040325: 100%, ENSRNOG00000013841: 100%
Entrez Gene ID: 9730
Uniprot ID: Q9Y4B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWD
• Gene Sequence: IAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWD
• Gene ID - Mouse: ENSMUSG00000040325
• Gene ID - Rat: ENSRNOG00000013841
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.