Anti DBX2 pAb (ATL-HPA066053)

Atlas Antibodies

Catalog No.:
ATL-HPA066053-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: developing brain homeobox 2
Gene Name: DBX2
Alternative Gene Name: FLJ16139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045608: 49%, ENSRNOG00000006885: 53%
Entrez Gene ID: 440097
Uniprot ID: Q6ZNG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTG
Gene Sequence SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTG
Gene ID - Mouse ENSMUSG00000045608
Gene ID - Rat ENSRNOG00000006885
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DBX2 pAb (ATL-HPA066053)
Datasheet Anti DBX2 pAb (ATL-HPA066053) Datasheet (External Link)
Vendor Page Anti DBX2 pAb (ATL-HPA066053) at Atlas Antibodies

Documents & Links for Anti DBX2 pAb (ATL-HPA066053)
Datasheet Anti DBX2 pAb (ATL-HPA066053) Datasheet (External Link)
Vendor Page Anti DBX2 pAb (ATL-HPA066053)