Anti DBR1 pAb (ATL-HPA035365 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035365-25

• 
• 
• 

Protein Description: debranching RNA lariats 1
Gene Name: DBR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032469: 69%, ENSRNOG00000014588: 71%
Entrez Gene ID: 51163
Uniprot ID: Q9UK59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTV
• Gene Sequence: SALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTV
• Gene ID - Mouse: ENSMUSG00000032469
• Gene ID - Rat: ENSRNOG00000014588
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.