Anti DBNL pAb (ATL-HPA027735 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA027735-100
  • Immunohistochemistry analysis in human lymph node and liver tissues using Anti-DBNL antibody. Corresponding DBNL RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-DBNL antibody HPA027735 (A) shows similar pattern to independent antibody HPA020265 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: drebrin-like
Gene Name: DBNL
Alternative Gene Name: HIP-55, SH3P7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020476: 90%, ENSRNOG00000012378: 86%
Entrez Gene ID: 28988
Uniprot ID: Q9UJU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen PPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGH
Gene Sequence PPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGH
Gene ID - Mouse ENSMUSG00000020476
Gene ID - Rat ENSRNOG00000012378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DBNL pAb (ATL-HPA027735 w/enhanced validation)
Datasheet Anti DBNL pAb (ATL-HPA027735 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DBNL pAb (ATL-HPA027735 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DBNL pAb (ATL-HPA027735 w/enhanced validation)
Datasheet Anti DBNL pAb (ATL-HPA027735 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DBNL pAb (ATL-HPA027735 w/enhanced validation)