Anti DBNDD1 pAb (ATL-HPA043018)

Atlas Antibodies

Catalog No.: ATL-HPA043018-25

Protein Description: dysbindin (dystrobrevin binding protein 1) domain containing 1
Gene Name: DBNDD1
Alternative Gene Name: FLJ12582, MGC3101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031970: 83%, ENSRNOG00000026974: 82%
Entrez Gene ID: 79007
Uniprot ID: Q9H9R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVE
• Gene Sequence: MSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVE
• Gene ID - Mouse: ENSMUSG00000031970
• Gene ID - Rat: ENSRNOG00000026974
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.