Anti DBNDD1 pAb (ATL-HPA043018)

Atlas Antibodies

Catalog No.:
ATL-HPA043018-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: dysbindin (dystrobrevin binding protein 1) domain containing 1
Gene Name: DBNDD1
Alternative Gene Name: FLJ12582, MGC3101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031970: 83%, ENSRNOG00000026974: 82%
Entrez Gene ID: 79007
Uniprot ID: Q9H9R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVE
Gene Sequence MSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVE
Gene ID - Mouse ENSMUSG00000031970
Gene ID - Rat ENSRNOG00000026974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DBNDD1 pAb (ATL-HPA043018)
Datasheet Anti DBNDD1 pAb (ATL-HPA043018) Datasheet (External Link)
Vendor Page Anti DBNDD1 pAb (ATL-HPA043018) at Atlas Antibodies

Documents & Links for Anti DBNDD1 pAb (ATL-HPA043018)
Datasheet Anti DBNDD1 pAb (ATL-HPA043018) Datasheet (External Link)
Vendor Page Anti DBNDD1 pAb (ATL-HPA043018)