Anti DBI pAb (ATL-HPA051428)

Atlas Antibodies

Catalog No.:
ATL-HPA051428-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Gene Name: DBI
Alternative Gene Name: ACBD1, ACBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026385: 82%, ENSRNOG00000046889: 79%
Entrez Gene ID: 1622
Uniprot ID: P07108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD
Gene Sequence MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD
Gene ID - Mouse ENSMUSG00000026385
Gene ID - Rat ENSRNOG00000046889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DBI pAb (ATL-HPA051428)
Datasheet Anti DBI pAb (ATL-HPA051428) Datasheet (External Link)
Vendor Page Anti DBI pAb (ATL-HPA051428) at Atlas Antibodies

Documents & Links for Anti DBI pAb (ATL-HPA051428)
Datasheet Anti DBI pAb (ATL-HPA051428) Datasheet (External Link)
Vendor Page Anti DBI pAb (ATL-HPA051428)
Citations for Anti DBI pAb (ATL-HPA051428) – 1 Found
Daňhelovská, Tereza; Zdražilová, Lucie; Štufková, Hana; Vanišová, Marie; Volfová, Nikol; Křížová, Jana; Kuda, Ondřej; Sládková, Jana; Tesařová, Markéta. Knock-Out of ACBD3 Leads to Dispersed Golgi Structure, but Unaffected Mitochondrial Functions in HEK293 and HeLa Cells. International Journal Of Molecular Sciences. 2021;22(14)  PubMed