Anti DBI pAb (ATL-HPA051428)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051428-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DBI
Alternative Gene Name: ACBD1, ACBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026385: 82%, ENSRNOG00000046889: 79%
Entrez Gene ID: 1622
Uniprot ID: P07108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD |
Gene Sequence | MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD |
Gene ID - Mouse | ENSMUSG00000026385 |
Gene ID - Rat | ENSRNOG00000046889 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DBI pAb (ATL-HPA051428) | |
Datasheet | Anti DBI pAb (ATL-HPA051428) Datasheet (External Link) |
Vendor Page | Anti DBI pAb (ATL-HPA051428) at Atlas Antibodies |
Documents & Links for Anti DBI pAb (ATL-HPA051428) | |
Datasheet | Anti DBI pAb (ATL-HPA051428) Datasheet (External Link) |
Vendor Page | Anti DBI pAb (ATL-HPA051428) |
Citations for Anti DBI pAb (ATL-HPA051428) – 1 Found |
Daňhelovská, Tereza; Zdražilová, Lucie; Štufková, Hana; Vanišová, Marie; Volfová, Nikol; Křížová, Jana; Kuda, Ondřej; Sládková, Jana; Tesařová, Markéta. Knock-Out of ACBD3 Leads to Dispersed Golgi Structure, but Unaffected Mitochondrial Functions in HEK293 and HeLa Cells. International Journal Of Molecular Sciences. 2021;22(14) PubMed |