Anti DBF4B pAb (ATL-HPA048465)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA048465-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $447.00
    
         
                            Gene Name: DBF4B
Alternative Gene Name: ASKL1, chifb, DRF1, FLJ13087, ZDBF1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032816: 21%, ENSRNOG00000033496: 22%
Entrez Gene ID: 80174
Uniprot ID: Q8NFT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | HPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLA | 
| Gene Sequence | HPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLA | 
| Gene ID - Mouse | ENSMUSG00000032816 | 
| Gene ID - Rat | ENSRNOG00000033496 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti DBF4B pAb (ATL-HPA048465) | |
| Datasheet | Anti DBF4B pAb (ATL-HPA048465) Datasheet (External Link) | 
| Vendor Page | Anti DBF4B pAb (ATL-HPA048465) at Atlas Antibodies | 
| Documents & Links for Anti DBF4B pAb (ATL-HPA048465) | |
| Datasheet | Anti DBF4B pAb (ATL-HPA048465) Datasheet (External Link) | 
| Vendor Page | Anti DBF4B pAb (ATL-HPA048465) |