Anti DBF4B pAb (ATL-HPA048465)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048465-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DBF4B
Alternative Gene Name: ASKL1, chifb, DRF1, FLJ13087, ZDBF1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032816: 21%, ENSRNOG00000033496: 22%
Entrez Gene ID: 80174
Uniprot ID: Q8NFT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLA |
| Gene Sequence | HPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLA |
| Gene ID - Mouse | ENSMUSG00000032816 |
| Gene ID - Rat | ENSRNOG00000033496 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DBF4B pAb (ATL-HPA048465) | |
| Datasheet | Anti DBF4B pAb (ATL-HPA048465) Datasheet (External Link) |
| Vendor Page | Anti DBF4B pAb (ATL-HPA048465) at Atlas Antibodies |
| Documents & Links for Anti DBF4B pAb (ATL-HPA048465) | |
| Datasheet | Anti DBF4B pAb (ATL-HPA048465) Datasheet (External Link) |
| Vendor Page | Anti DBF4B pAb (ATL-HPA048465) |