Anti DBF4 pAb (ATL-HPA042923)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042923-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DBF4
Alternative Gene Name: ASK, chif, DBF4A, ZDBF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002297: 33%, ENSRNOG00000050482: 35%
Entrez Gene ID: 10926
Uniprot ID: Q9UBU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ |
Gene Sequence | PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ |
Gene ID - Mouse | ENSMUSG00000002297 |
Gene ID - Rat | ENSRNOG00000050482 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DBF4 pAb (ATL-HPA042923) | |
Datasheet | Anti DBF4 pAb (ATL-HPA042923) Datasheet (External Link) |
Vendor Page | Anti DBF4 pAb (ATL-HPA042923) at Atlas Antibodies |
Documents & Links for Anti DBF4 pAb (ATL-HPA042923) | |
Datasheet | Anti DBF4 pAb (ATL-HPA042923) Datasheet (External Link) |
Vendor Page | Anti DBF4 pAb (ATL-HPA042923) |