Anti DBF4 pAb (ATL-HPA042923)

Atlas Antibodies

SKU: ATL-HPA042923-25

• 

Protein Description: DBF4 zinc finger
Gene Name: DBF4
Alternative Gene Name: ASK, chif, DBF4A, ZDBF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002297: 33%, ENSRNOG00000050482: 35%
Entrez Gene ID: 10926
Uniprot ID: Q9UBU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
• Gene Sequence: PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
• Gene ID - Mouse: ENSMUSG00000002297
• Gene ID - Rat: ENSRNOG00000050482
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.