Anti DBF4 pAb (ATL-HPA042923)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042923-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DBF4
Alternative Gene Name: ASK, chif, DBF4A, ZDBF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002297: 33%, ENSRNOG00000050482: 35%
Entrez Gene ID: 10926
Uniprot ID: Q9UBU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ |
| Gene Sequence | PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ |
| Gene ID - Mouse | ENSMUSG00000002297 |
| Gene ID - Rat | ENSRNOG00000050482 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DBF4 pAb (ATL-HPA042923) | |
| Datasheet | Anti DBF4 pAb (ATL-HPA042923) Datasheet (External Link) |
| Vendor Page | Anti DBF4 pAb (ATL-HPA042923) at Atlas Antibodies |
| Documents & Links for Anti DBF4 pAb (ATL-HPA042923) | |
| Datasheet | Anti DBF4 pAb (ATL-HPA042923) Datasheet (External Link) |
| Vendor Page | Anti DBF4 pAb (ATL-HPA042923) |