Anti DAZL pAb (ATL-HPA019777 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019777-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using HPA019777 antibody. Corresponding DAZL RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DAZL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400541).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: deleted in azoospermia-like
Gene Name: DAZL
Alternative Gene Name: DAZH, DAZL1, DAZLA, MGC26406, SPGYLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010592: 92%, ENSRNOG00000023474: 92%
Entrez Gene ID: 1618
Uniprot ID: Q92904
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK
Gene Sequence HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK
Gene ID - Mouse ENSMUSG00000010592
Gene ID - Rat ENSRNOG00000023474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DAZL pAb (ATL-HPA019777 w/enhanced validation)
Datasheet Anti DAZL pAb (ATL-HPA019777 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DAZL pAb (ATL-HPA019777 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DAZL pAb (ATL-HPA019777 w/enhanced validation)
Datasheet Anti DAZL pAb (ATL-HPA019777 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DAZL pAb (ATL-HPA019777 w/enhanced validation)



Citations for Anti DAZL pAb (ATL-HPA019777 w/enhanced validation) – 1 Found
Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.  PubMed