Anti DAZL pAb (ATL-HPA019777 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019777-25

• 
• 

Protein Description: deleted in azoospermia-like
Gene Name: DAZL
Alternative Gene Name: DAZH, DAZL1, DAZLA, MGC26406, SPGYLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010592: 92%, ENSRNOG00000023474: 92%
Entrez Gene ID: 1618
Uniprot ID: Q92904
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK
• Gene Sequence: HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK
• Gene ID - Mouse: ENSMUSG00000010592
• Gene ID - Rat: ENSRNOG00000023474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DAZL pAb (ATL-HPA019777 w/enhanced validation) – 1 Found

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.