Anti DAZAP1 pAb (ATL-HPA004631 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA004631-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA004631 antibody. Corresponding DAZAP1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DAZ associated protein 1
Gene Name: DAZAP1
Alternative Gene Name: MGC19907
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069565: 99%, ENSRNOG00000031387: 99%
Entrez Gene ID: 26528
Uniprot ID: Q96EP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen STTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPR
Gene Sequence STTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPR
Gene ID - Mouse ENSMUSG00000069565
Gene ID - Rat ENSRNOG00000031387
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DAZAP1 pAb (ATL-HPA004631 w/enhanced validation)
Datasheet Anti DAZAP1 pAb (ATL-HPA004631 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DAZAP1 pAb (ATL-HPA004631 w/enhanced validation)