Anti DAXX pAb (ATL-HPA008736 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008736-25

• 
• 

Protein Description: death-domain associated protein
Gene Name: DAXX
Alternative Gene Name: DAP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002307: 47%, ENSRNOG00000000477: 50%
Entrez Gene ID: 1616
Uniprot ID: Q9UER7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG
• Gene Sequence: DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG
• Gene ID - Mouse: ENSMUSG00000002307
• Gene ID - Rat: ENSRNOG00000000477
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DAXX pAb (ATL-HPA008736 w/enhanced validation) – 32 Found

Mäkinen, Netta; Aavikko, Mervi; Heikkinen, Tuomas; Taipale, Minna; Taipale, Jussi; Koivisto-Korander, Riitta; Bützow, Ralf; Vahteristo, Pia. Exome Sequencing of Uterine Leiomyosarcomas Identifies Frequent Mutations in TP53, ATRX, and MED12. Plos Genetics. 2016;12(2):e1005850. 

Singhi, Aatur D; Liu, Ta-Chiang; Roncaioli, Justin L; Cao, Dengfeng; Zeh, Herbert J; Zureikat, Amer H; Tsung, Allan; Marsh, J Wallis; Lee, Kenneth K; Hogg, Melissa E; Bahary, Nathan; Brand, Randall E; McGrath, Kevin M; Slivka, Adam; Cressman, Kristi L; Fuhrer, Kimberly; O'Sullivan, Roderick J. Alternative Lengthening of Telomeres and Loss of DAXX/ATRX Expression Predicts Metastatic Disease and Poor Survival in Patients with Pancreatic Neuroendocrine Tumors. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2017;23(2):600-609. 

Vinagre, João; Nabais, Joana; Pinheiro, Jorge; Batista, Rui; Oliveira, Rui Caetano; Gonçalves, António Pedro; Pestana, Ana; Reis, Marta; Mesquita, Bárbara; Pinto, Vasco; Lyra, Joana; Cipriano, Maria Augusta; Ferreira, Miguel Godinho; Lopes, José Manuel; Sobrinho-Simões, Manuel; Soares, Paula. TERT promoter mutations in pancreatic endocrine tumours are rare and mainly found in tumours from patients with hereditary syndromes. Scientific Reports. 2016;6( 27411289):29714. 

Slatter, Tania L; Hsia, Howard; Samaranayaka, Ari; Sykes, Peter; Clow, William Bill; Devenish, Celia J; Sutton, Tim; Royds, Janice A; Ip, Philip P; Cheung, Annie N; Hung, Noelyn Anne. Loss of ATRX and DAXX expression identifies poor prognosis for smooth muscle tumours of uncertain malignant potential and early stage uterine leiomyosarcoma. The Journal Of Pathology. Clinical Research. 2015;1(2):95-105. 

Park, Joo Kyung; Paik, Woo Hyun; Lee, Kyoungbun; Ryu, Ji Kon; Lee, Sang Hyub; Kim, Yong-Tae. DAXX/ATRX and MEN1 genes are strong prognostic markers in pancreatic neuroendocrine tumors. Oncotarget. 2017;8(30):49796-49806. 

Bell, W Robert; Meeker, Alan K; Rizzo, Anthony; Rajpara, Sumit; Rosenthal, Ian M; Flores Bellver, Miguel; Aparicio Domingo, Silvia; Zhong, Xiufeng; Barber, John R; Joshu, Corinne E; Canto-Soler, M Valeria; Eberhart, Charles G; Heaphy, Christopher M. A unique telomere DNA expansion phenotype in human retinal rod photoreceptors associated with aging and disease. Brain Pathology (Zurich, Switzerland). 2019;29(1):45-52. 

Brosnan-Cashman, Jacqueline A; Yuan, Ming; Graham, Mindy K; Rizzo, Anthony J; Myers, Kaylar M; Davis, Christine; Zhang, Rebecca; Esopi, David M; Raabe, Eric H; Eberhart, Charles G; Heaphy, Christopher M; Meeker, Alan K. ATRX loss induces multiple hallmarks of the alternative lengthening of telomeres (ALT) phenotype in human glioma cell lines in a cell line-specific manner. Plos One. 13(9):e0204159. 

Hossain, Md Golzar; Ohsaki, Eriko; Honda, Tomoyuki; Ueda, Keiji. Importance of Promyelocytic Leukema Protein (PML) for Kaposi's Sarcoma-Associated Herpesvirus Lytic Replication. Frontiers In Microbiology. 9( 30349510):2324. 

Liverani, Chiara; Bongiovanni, Alberto; Mercatali, Laura; Foca, Flavia; Pieri, Federica; De Vita, Alessandro; Spadazzi, Chiara; Miserocchi, Giacomo; Recine, Federica; Riva, Nada; Nicolini, Silvia; Severi, Stefano; Martinelli, Giovanni; Ibrahim, Toni. Grading of Neuroendocrine Carcinomas: Correlation of (68)Ga-PET/CT Scan with Tissue Biomarkers. Disease Markers. 2018( 30627226):6878409. 

Jin, Cao; Hacking, Sean; Komforti, Miglena K; Nasim, Mansoor. A Comparison of Death Domain-Associated Protein 6 in Different Endometrial Carcinomas Histotypes. Biomarker Insights. 14( 31384126):1177271919864892. 

Rodriguez, Fausto J; Graham, Mindy K; Brosnan-Cashman, Jacqueline A; Barber, John R; Davis, Christine; Vizcaino, M Adelita; Palsgrove, Doreen N; Giannini, Caterina; Pekmezci, Melike; Dahiya, Sonika; Gokden, Murat; Noë, Michael; Wood, Laura D; Pratilas, Christine A; Morris, Carol D; Belzberg, Allan; Blakeley, Jaishri; Heaphy, Christopher M. Telomere alterations in neurofibromatosis type 1-associated solid tumors. Acta Neuropathologica Communications. 2019;7(1):139. 

Hammond, Colin M; Bao, Hongyu; Hendriks, Ivo A; Carraro, Massimo; García-Nieto, Alberto; Liu, Yanhong; Reverón-Gómez, Nazaret; Spanos, Christos; Chen, Liu; Rappsilber, Juri; Nielsen, Michael L; Patel, Dinshaw J; Huang, Hongda; Groth, Anja. DNAJC9 integrates heat shock molecular chaperones into the histone chaperone network. Molecular Cell. 2021;81(12):2533-2548.e9. 

Yanai, Hirotsugu; Ishida, Mitsuaki; Yoshikawa, Katsuhiro; Tsuta, Koji; Sekimoto, Mitsugu; Sugie, Tomoharu. Immunohistochemical analyses of the expression profiles of INSM1, ATRX, DAXX and DLL3 in solid papillary carcinomas of the breast. Oncology Letters. 2022;23(4):137. 

Heaphy, Christopher M; de Wilde, Roeland F; Jiao, Yuchen; Klein, Alison P; Edil, Barish H; Shi, Chanjuan; Bettegowda, Chetan; Rodriguez, Fausto J; Eberhart, Charles G; Hebbar, Sachidanand; Offerhaus, G Johan; McLendon, Roger; Rasheed, B Ahmed; He, Yiping; Yan, Hai; Bigner, Darell D; Oba-Shinjo, Sueli Mieko; Marie, Suely Kazue Nagahashi; Riggins, Gregory J; Kinzler, Kenneth W; Vogelstein, Bert; Hruban, Ralph H; Maitra, Anirban; Papadopoulos, Nickolas; Meeker, Alan K. Altered telomeres in tumors with ATRX and DAXX mutations. Science (New York, N.y.). 2011;333(6041):425. 

Schwartzentruber, Jeremy; Korshunov, Andrey; Liu, Xiao-Yang; Jones, David T W; Pfaff, Elke; Jacob, Karine; Sturm, Dominik; Fontebasso, Adam M; Quang, Dong-Anh Khuong; Tönjes, Martje; Hovestadt, Volker; Albrecht, Steffen; Kool, Marcel; Nantel, Andre; Konermann, Carolin; Lindroth, Anders; Jäger, Natalie; Rausch, Tobias; Ryzhova, Marina; Korbel, Jan O; Hielscher, Thomas; Hauser, Peter; Garami, Miklos; Klekner, Almos; Bognar, Laszlo; Ebinger, Martin; Schuhmann, Martin U; Scheurlen, Wolfram; Pekrun, Arnulf; Frühwald, Michael C; Roggendorf, Wolfgang; Kramm, Christoph; Dürken, Matthias; Atkinson, Jeffrey; Lepage, Pierre; Montpetit, Alexandre; Zakrzewska, Magdalena; Zakrzewski, Krzystof; Liberski, Pawel P; Dong, Zhifeng; Siegel, Peter; Kulozik, Andreas E; Zapatka, Marc; Guha, Abhijit; Malkin, David; Felsberg, Jörg; Reifenberger, Guido; von Deimling, Andreas; Ichimura, Koichi; Collins, V Peter; Witt, Hendrik; Milde, Till; Witt, Olaf; Zhang, Cindy; Castelo-Branco, Pedro; Lichter, Peter; Faury, Damien; Tabori, Uri; Plass, Christoph; Majewski, Jacek; Pfister, Stefan M; Jabado, Nada. Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma. Nature. 2012;482(7384):226-31. 

de Wilde, Roeland F; Heaphy, Christopher M; Maitra, Anirban; Meeker, Alan K; Edil, Barish H; Wolfgang, Christopher L; Ellison, Trevor A; Schulick, Richard D; Molenaar, I Quintus; Valk, Gerlof D; Vriens, Menno R; Borel Rinkes, Inne H M; Offerhaus, G Johan A; Hruban, Ralph H; Matsukuma, Karen E. Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2012;25(7):1033-9. 

Stepp, Wesley H; Meyers, Jordan M; McBride, Alison A. Sp100 provides intrinsic immunity against human papillomavirus infection. Mbio. 2013;4(6):e00845-13. 

Fishbein, Lauren; Khare, Sanika; Wubbenhorst, Bradley; DeSloover, Daniel; D'Andrea, Kurt; Merrill, Shana; Cho, Nam Woo; Greenberg, Roger A; Else, Tobias; Montone, Kathleen; LiVolsi, Virginia; Fraker, Douglas; Daber, Robert; Cohen, Debbie L; Nathanson, Katherine L. Whole-exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas. Nature Communications. 2015;6( 25608029):6140. 

Pipinikas, Christodoulos P; Dibra, Harpreet; Karpathakis, Anna; Feber, Andrew; Novelli, Marco; Oukrif, Dahmane; Fusai, Guiseppe; Valente, Roberto; Caplin, Martyn; Meyer, Tim; Teschendorff, Andrew; Bell, Christopher; Morris, Tiffany J; Salomoni, Paolo; Luong, Tu-Vinh; Davidson, Brian; Beck, Stephan; Thirlwell, Christina. Epigenetic dysregulation and poorer prognosis in DAXX-deficient pancreatic neuroendocrine tumours. Endocrine-Related Cancer. 2015;22(3):L13-8. 

Napier, Christine E; Huschtscha, Lily I; Harvey, Adam; Bower, Kylie; Noble, Jane R; Hendrickson, Eric A; Reddel, Roger R. ATRX represses alternative lengthening of telomeres. Oncotarget. 2015;6(18):16543-58. 

Kim, Joo Young; Brosnan-Cashman, Jacqueline A; An, Soyeon; Kim, Sung Joo; Song, Ki-Byung; Kim, Min-Sun; Kim, Mi-Ju; Hwang, Dae Wook; Meeker, Alan K; Yu, Eunsil; Kim, Song Cheol; Hruban, Ralph H; Heaphy, Christopher M; Hong, Seung-Mo. Alternative Lengthening of Telomeres in Primary Pancreatic Neuroendocrine Tumors Is Associated with Aggressive Clinical Behavior and Poor Survival. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2017;23(6):1598-1606. 

Lin, Ching-Wen; Wang, Lu-Kai; Wang, Shu-Ping; Chang, Yi-Liang; Wu, Yi-Ying; Chen, Hsuan-Yu; Hsiao, Tzu-Hung; Lai, Wei-Yun; Lu, Hsuan-Hsuan; Chang, Ya-Hsuan; Yang, Shuenn-Chen; Lin, Ming-Wei; Chen, Chi-Yuan; Hong, Tse-Ming; Yang, Pan-Chyr. Daxx inhibits hypoxia-induced lung cancer cell metastasis by suppressing the HIF-1α/HDAC1/Slug axis. Nature Communications. 2016;7( 28004751):13867. 

VandenBussche, Christopher J; Allison, Derek B; Graham, Mindy K; Charu, Vivek; Lennon, Anne Marie; Wolfgang, Christopher L; Hruban, Ralph H; Heaphy, Christopher M. Alternative lengthening of telomeres and ATRX/DAXX loss can be reliably detected in FNAs of pancreatic neuroendocrine tumors. Cancer Cytopathology. 2017;125(7):544-551. 

Mohamed, Amira; Romano, David; Saveanu, Alexandru; Roche, Catherine; Albertelli, Manuela; Barbieri, Federica; Brue, Thierry; Niccoli, Patricia; Delpero, Jean-Robert; Garcia, Stephane; Ferone, Diego; Florio, Tullio; Moutardier, Vincent; Poizat, Flora; Barlier, Anne; Gerard, Corinne. Anti-proliferative and anti-secretory effects of everolimus on human pancreatic neuroendocrine tumors primary cultures: is there any benefit from combination with somatostatin analogs?. Oncotarget. 2017;8(25):41044-41063. 

Rodriguez, Fausto J; Brosnan-Cashman, Jacqueline A; Allen, Sariah J; Vizcaino, M Adelita; Giannini, Caterina; Camelo-Piragua, Sandra; Webb, Milad; Matsushita, Marcus; Wadhwani, Nitin; Tabbarah, Abeer; Hamideh, Dima; Jiang, Liqun; Chen, Liam; Arvanitis, Leonidas D; Alnajar, Hussein H; Barber, John R; Rodríguez-Velasco, Alicia; Orr, Brent; Heaphy, Christopher M. Alternative lengthening of telomeres, ATRX loss and H3-K27M mutations in histologically defined pilocytic astrocytoma with anaplasia. Brain Pathology (Zurich, Switzerland). 2019;29(1):126-140. 

Graham, Mindy K; Kim, Jiyoung; Da, Joseph; Brosnan-Cashman, Jacqueline A; Rizzo, Anthony; Baena Del Valle, Javier A; Chia, Lionel; Rubenstein, Michael; Davis, Christine; Zheng, Qizhi; Cope, Leslie; Considine, Michael; Haffner, Michael C; De Marzo, Angelo M; Meeker, Alan K; Heaphy, Christopher M. Functional Loss of ATRX and TERC Activates Alternative Lengthening of Telomeres (ALT) in LAPC4 Prostate Cancer Cells. Molecular Cancer Research : Mcr. 2019;17(12):2480-2491. 

Hackeng, Wenzel M; Schelhaas, Willemien; Morsink, Folkert H M; Heidsma, Charlotte M; van Eeden, Susanne; Valk, Gerlof D; Vriens, Menno R; Heaphy, Christopher M; Nieveen van Dijkum, Els J M; Offerhaus, G Johan A; Dreijerink, Koen M A; Brosens, Lodewijk A A. Alternative Lengthening of Telomeres and Differential Expression of Endocrine Transcription Factors Distinguish Metastatic and Non-metastatic Insulinomas. Endocrine Pathology. 2020;31(2):108-118. 

Davidson, Ben; McFadden, Erin; Holth, Arild; Brunetti, Marta; Flørenes, Vivi Ann. Death domain-associated protein (DAXX) expression is associated with poor survival in metastatic high-grade serous carcinoma. Virchows Archiv : An International Journal Of Pathology. 2020;477(6):857-864. 

Hackeng, Wenzel M; Brosens, Lodewijk A A; Kim, Joo Young; O'Sullivan, Roderick; Sung, You-Na; Liu, Ta-Chiang; Cao, Dengfeng; Heayn, Michelle; Brosnan-Cashman, Jacqueline; An, Soyeon; Morsink, Folkert H M; Heidsma, Charlotte M; Valk, Gerlof D; Vriens, Menno R; Nieveen van Dijkum, Els; Offerhaus, G Johan A; Dreijerink, Koen M A; Zeh, Herbert; Zureikat, Amer H; Hogg, Melissa; Lee, Kenneth; Geller, David; Marsh, J Wallis; Paniccia, Alessandro; Ongchin, Melanie; Pingpank, James F; Bahary, Nathan; Aijazi, Muaz; Brand, Randall; Chennat, Jennifer; Das, Rohit; Fasanella, Kenneth E; Khalid, Asif; McGrath, Kevin; Sarkaria, Savreet; Singh, Harkirat; Slivka, Adam; Nalesnik, Michael; Han, Xiaoli; Nikiforova, Marina N; Lawlor, Rita Teresa; Mafficini, Andrea; Rusev, Boris; Corbo, Vincenzo; Luchini, Claudio; Bersani, Samantha; Pea, Antonio; Cingarlini, Sara; Landoni, Luca; Salvia, Roberto; Milione, Massimo; Milella, Michele; Scarpa, Aldo; Hong, Seung-Mo; Heaphy, Christopher M; Singhi, Aatur D. Non-functional pancreatic neuroendocrine tumours: ATRX/DAXX and alternative lengthening of telomeres (ALT) are prognostically independent from ARX/PDX1 expression and tumour size. Gut. 2022;71(5):961-973. 

Bremer, Sebastian C B; Bittner, Gabi; Elakad, Omar; Dinter, Helen; Gaedcke, Jochen; König, Alexander O; Amanzada, Ahmad; Ellenrieder, Volker; Freiherr von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. Enhancer of Zeste Homolog 2 (EZH2) Is a Marker of High-Grade Neuroendocrine Neoplasia in Gastroenteropancreatic and Pulmonary Tract and Predicts Poor Prognosis. Cancers. 2022;14(12) 

Heaphy, Christopher M; Bi, Wenya Linda; Coy, Shannon; Davis, Christine; Gallia, Gary L; Santagata, Sandro; Rodriguez, Fausto J. Telomere length alterations and ATRX/DAXX loss in pituitary adenomas. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2020;33(8):1475-1481. 

de Nonneville, Alexandre; Salas, Sébastien; Bertucci, François; Sobinoff, Alexander P; Adélaïde, José; Guille, Arnaud; Finetti, Pascal; Noble, Jane R; Churikov, Dimitri; Chaffanet, Max; Lavit, Elise; Pickett, Hilda A; Bouvier, Corinne; Birnbaum, Daniel; Reddel, Roger R; Géli, Vincent. TOP3A amplification and ATRX inactivation are mutually exclusive events in pediatric osteosarcomas using ALT. Embo Molecular Medicine. 2022;14(10):e15859.