Anti DARS2 pAb (ATL-HPA026528 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026528-25
  • Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-DARS2 antibody HPA026528 (A) shows similar protein distribution across tissues to independent antibody HPA026506 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
  • Western blot analysis using Anti-DARS2 antibody HPA026528 (A) shows similar pattern to independent antibody HPA026506 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aspartyl-tRNA synthetase 2, mitochondrial
Gene Name: DARS2
Alternative Gene Name: FLJ10514
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026709: 69%, ENSRNOG00000002813: 70%
Entrez Gene ID: 55157
Uniprot ID: Q6PI48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTA
Gene Sequence LSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTA
Gene ID - Mouse ENSMUSG00000026709
Gene ID - Rat ENSRNOG00000002813
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DARS2 pAb (ATL-HPA026528 w/enhanced validation)
Datasheet Anti DARS2 pAb (ATL-HPA026528 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DARS2 pAb (ATL-HPA026528 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DARS2 pAb (ATL-HPA026528 w/enhanced validation)
Datasheet Anti DARS2 pAb (ATL-HPA026528 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DARS2 pAb (ATL-HPA026528 w/enhanced validation)