Anti DAPP1 pAb (ATL-HPA046074)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046074-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DAPP1
Alternative Gene Name: BAM32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028159: 96%, ENSRNOG00000010575: 94%
Entrez Gene ID: 27071
Uniprot ID: Q9UN19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG |
Gene Sequence | HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG |
Gene ID - Mouse | ENSMUSG00000028159 |
Gene ID - Rat | ENSRNOG00000010575 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DAPP1 pAb (ATL-HPA046074) | |
Datasheet | Anti DAPP1 pAb (ATL-HPA046074) Datasheet (External Link) |
Vendor Page | Anti DAPP1 pAb (ATL-HPA046074) at Atlas Antibodies |
Documents & Links for Anti DAPP1 pAb (ATL-HPA046074) | |
Datasheet | Anti DAPP1 pAb (ATL-HPA046074) Datasheet (External Link) |
Vendor Page | Anti DAPP1 pAb (ATL-HPA046074) |