Anti DAPP1 pAb (ATL-HPA046074)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046074-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DAPP1
Alternative Gene Name: BAM32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028159: 96%, ENSRNOG00000010575: 94%
Entrez Gene ID: 27071
Uniprot ID: Q9UN19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG |
| Gene Sequence | HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG |
| Gene ID - Mouse | ENSMUSG00000028159 |
| Gene ID - Rat | ENSRNOG00000010575 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DAPP1 pAb (ATL-HPA046074) | |
| Datasheet | Anti DAPP1 pAb (ATL-HPA046074) Datasheet (External Link) |
| Vendor Page | Anti DAPP1 pAb (ATL-HPA046074) at Atlas Antibodies |
| Documents & Links for Anti DAPP1 pAb (ATL-HPA046074) | |
| Datasheet | Anti DAPP1 pAb (ATL-HPA046074) Datasheet (External Link) |
| Vendor Page | Anti DAPP1 pAb (ATL-HPA046074) |