Anti DAPK3 pAb (ATL-HPA064809)

Atlas Antibodies

Catalog No.:
ATL-HPA064809-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: death-associated protein kinase 3
Gene Name: DAPK3
Alternative Gene Name: ZIP, ZIPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034974: 67%, ENSRNOG00000020383: 67%
Entrez Gene ID: 1613
Uniprot ID: O43293
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPKRRMTIAQSLEHSWIKAIRRRNVRGEDS
Gene Sequence DPKRRMTIAQSLEHSWIKAIRRRNVRGEDS
Gene ID - Mouse ENSMUSG00000034974
Gene ID - Rat ENSRNOG00000020383
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DAPK3 pAb (ATL-HPA064809)
Datasheet Anti DAPK3 pAb (ATL-HPA064809) Datasheet (External Link)
Vendor Page Anti DAPK3 pAb (ATL-HPA064809) at Atlas Antibodies

Documents & Links for Anti DAPK3 pAb (ATL-HPA064809)
Datasheet Anti DAPK3 pAb (ATL-HPA064809) Datasheet (External Link)
Vendor Page Anti DAPK3 pAb (ATL-HPA064809)