Anti DAPK3 pAb (ATL-HPA028569)

Atlas Antibodies

Catalog No.: ATL-HPA028569-25

Protein Description: death-associated protein kinase 3
Gene Name: DAPK3
Alternative Gene Name: ZIP, ZIPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034974: 64%, ENSRNOG00000020383: 63%
Entrez Gene ID: 1613
Uniprot ID: O43293
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLV
• Gene Sequence: AIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLV
• Gene ID - Mouse: ENSMUSG00000034974
• Gene ID - Rat: ENSRNOG00000020383
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.