Anti DAPK3 pAb (ATL-HPA028569)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028569-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DAPK3
Alternative Gene Name: ZIP, ZIPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034974: 64%, ENSRNOG00000020383: 63%
Entrez Gene ID: 1613
Uniprot ID: O43293
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLV |
Gene Sequence | AIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLV |
Gene ID - Mouse | ENSMUSG00000034974 |
Gene ID - Rat | ENSRNOG00000020383 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DAPK3 pAb (ATL-HPA028569) | |
Datasheet | Anti DAPK3 pAb (ATL-HPA028569) Datasheet (External Link) |
Vendor Page | Anti DAPK3 pAb (ATL-HPA028569) at Atlas Antibodies |
Documents & Links for Anti DAPK3 pAb (ATL-HPA028569) | |
Datasheet | Anti DAPK3 pAb (ATL-HPA028569) Datasheet (External Link) |
Vendor Page | Anti DAPK3 pAb (ATL-HPA028569) |