Anti DAPK1 pAb (ATL-HPA048436)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048436-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DAPK1
Alternative Gene Name: DAPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021559: 94%, ENSRNOG00000018198: 95%
Entrez Gene ID: 1612
Uniprot ID: P53355
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHD |
| Gene Sequence | HKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHD |
| Gene ID - Mouse | ENSMUSG00000021559 |
| Gene ID - Rat | ENSRNOG00000018198 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DAPK1 pAb (ATL-HPA048436) | |
| Datasheet | Anti DAPK1 pAb (ATL-HPA048436) Datasheet (External Link) |
| Vendor Page | Anti DAPK1 pAb (ATL-HPA048436) at Atlas Antibodies |
| Documents & Links for Anti DAPK1 pAb (ATL-HPA048436) | |
| Datasheet | Anti DAPK1 pAb (ATL-HPA048436) Datasheet (External Link) |
| Vendor Page | Anti DAPK1 pAb (ATL-HPA048436) |
| Citations for Anti DAPK1 pAb (ATL-HPA048436) – 1 Found |
| Zhang, Xianyi; Xu, Runtao; Feng, Wenjing; Xu, Jiapeng; Liang, Yulong; Mu, Jinghui. Autophagy-related genes contribute to malignant progression and have a clinical prognostic impact in colon adenocarcinoma. Experimental And Therapeutic Medicine. 2021;22(3):932. PubMed |