Anti DAPK1 pAb (ATL-HPA048436)

Atlas Antibodies

Catalog No.:
ATL-HPA048436-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: death-associated protein kinase 1
Gene Name: DAPK1
Alternative Gene Name: DAPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021559: 94%, ENSRNOG00000018198: 95%
Entrez Gene ID: 1612
Uniprot ID: P53355
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHD
Gene Sequence HKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHD
Gene ID - Mouse ENSMUSG00000021559
Gene ID - Rat ENSRNOG00000018198
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DAPK1 pAb (ATL-HPA048436)
Datasheet Anti DAPK1 pAb (ATL-HPA048436) Datasheet (External Link)
Vendor Page Anti DAPK1 pAb (ATL-HPA048436) at Atlas Antibodies

Documents & Links for Anti DAPK1 pAb (ATL-HPA048436)
Datasheet Anti DAPK1 pAb (ATL-HPA048436) Datasheet (External Link)
Vendor Page Anti DAPK1 pAb (ATL-HPA048436)
Citations for Anti DAPK1 pAb (ATL-HPA048436) – 1 Found
Zhang, Xianyi; Xu, Runtao; Feng, Wenjing; Xu, Jiapeng; Liang, Yulong; Mu, Jinghui. Autophagy-related genes contribute to malignant progression and have a clinical prognostic impact in colon adenocarcinoma. Experimental And Therapeutic Medicine. 2021;22(3):932.  PubMed