Anti DAP3 pAb (ATL-HPA023687)

Atlas Antibodies

SKU: ATL-HPA023687-25

• 
• 
• 

Protein Description: death associated protein 3
Gene Name: DAP3
Alternative Gene Name: bMRP-10, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068921: 84%, ENSRNOG00000020373: 86%
Entrez Gene ID: 7818
Uniprot ID: P51398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF
• Gene Sequence: GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF
• Gene ID - Mouse: ENSMUSG00000068921
• Gene ID - Rat: ENSRNOG00000020373
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DAP3 pAb (ATL-HPA023687) – 1 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.