Anti DAP pAb (ATL-HPA029456)

Atlas Antibodies

SKU:
ATL-HPA029456-25
  • Immunohistochemical staining of human prostate shows moderate granular positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: death-associated protein
Gene Name: DAP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024669: 27%, ENSRNOG00000023688: 25%
Entrez Gene ID: 1611
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFRPNPTLLGNLRQNQVLCPLPYISIFKTRNSSSPNLVYGESGWMSFEDHCAPRGAISRICQDPRKILALVLFQQSP
Gene Sequence QFRPNPTLLGNLRQNQVLCPLPYISIFKTRNSSSPNLVYGESGWMSFEDHCAPRGAISRICQDPRKILALVLFQQSP
Gene ID - Mouse ENSMUSG00000024669
Gene ID - Rat ENSRNOG00000023688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DAP pAb (ATL-HPA029456)
Datasheet Anti DAP pAb (ATL-HPA029456) Datasheet (External Link)
Vendor Page Anti DAP pAb (ATL-HPA029456) at Atlas Antibodies

Documents & Links for Anti DAP pAb (ATL-HPA029456)
Datasheet Anti DAP pAb (ATL-HPA029456) Datasheet (External Link)
Vendor Page Anti DAP pAb (ATL-HPA029456)