Anti DAO pAb (ATL-HPA038654 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA038654-25
  • Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-DAO antibody. Corresponding DAO RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: D-amino-acid oxidase
Gene Name: DAO
Alternative Gene Name: DAMOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042096: 81%, ENSRNOG00000054962: 77%
Entrez Gene ID: 1610
Uniprot ID: P14920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHE
Gene Sequence QPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHE
Gene ID - Mouse ENSMUSG00000042096
Gene ID - Rat ENSRNOG00000054962
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DAO pAb (ATL-HPA038654 w/enhanced validation)
Datasheet Anti DAO pAb (ATL-HPA038654 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DAO pAb (ATL-HPA038654 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DAO pAb (ATL-HPA038654 w/enhanced validation)
Datasheet Anti DAO pAb (ATL-HPA038654 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DAO pAb (ATL-HPA038654 w/enhanced validation)