Anti DALRD3 pAb (ATL-HPA036862)

Atlas Antibodies

SKU:
ATL-HPA036862-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DALR anticodon binding domain containing 3
Gene Name: DALRD3
Alternative Gene Name: FLJ10496
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019039: 69%, ENSRNOG00000020159: 69%
Entrez Gene ID: 55152
Uniprot ID: Q5D0E6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQEALWHWPEDSHPGLAGASDTGTGGCLVVHVVSCEEEFQQQKLDLLWRKLVDKAPLRQKHLICGPVKVAGAPGTLMTAPEYYEFR
Gene Sequence LQEALWHWPEDSHPGLAGASDTGTGGCLVVHVVSCEEEFQQQKLDLLWRKLVDKAPLRQKHLICGPVKVAGAPGTLMTAPEYYEFR
Gene ID - Mouse ENSMUSG00000019039
Gene ID - Rat ENSRNOG00000020159
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DALRD3 pAb (ATL-HPA036862)
Datasheet Anti DALRD3 pAb (ATL-HPA036862) Datasheet (External Link)
Vendor Page Anti DALRD3 pAb (ATL-HPA036862) at Atlas Antibodies

Documents & Links for Anti DALRD3 pAb (ATL-HPA036862)
Datasheet Anti DALRD3 pAb (ATL-HPA036862) Datasheet (External Link)
Vendor Page Anti DALRD3 pAb (ATL-HPA036862)