Anti DACT2 pAb (ATL-HPA030251)

Atlas Antibodies

Catalog No.: ATL-HPA030251-25

Protein Description: dishevelled-binding antagonist of beta-catenin 2
Gene Name: DACT2
Alternative Gene Name: bA503C24.7, C6orf116, DAPPER2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048826: 39%, ENSRNOG00000022921: 52%
Entrez Gene ID: 168002
Uniprot ID: Q5SW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRSCSESTL
• Gene Sequence: DKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRSCSESTL
• Gene ID - Mouse: ENSMUSG00000048826
• Gene ID - Rat: ENSRNOG00000022921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DACT2 pAb (ATL-HPA030251) – 1 Found

Yi, Zhen; Ouyang, Jiamin; Sun, Wenmin; Li, Shiqiang; Xiao, Xueshan; Zhang, Qingjiong. Comparative exome sequencing reveals novel candidate genes for retinitis pigmentosa. Ebiomedicine. 2020;56( 32454406):102792.