Anti DACT2 pAb (ATL-HPA030251)

Atlas Antibodies

Catalog No.:
ATL-HPA030251-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dishevelled-binding antagonist of beta-catenin 2
Gene Name: DACT2
Alternative Gene Name: bA503C24.7, C6orf116, DAPPER2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048826: 39%, ENSRNOG00000022921: 52%
Entrez Gene ID: 168002
Uniprot ID: Q5SW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRSCSESTL
Gene Sequence DKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRSCSESTL
Gene ID - Mouse ENSMUSG00000048826
Gene ID - Rat ENSRNOG00000022921
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DACT2 pAb (ATL-HPA030251)
Datasheet Anti DACT2 pAb (ATL-HPA030251) Datasheet (External Link)
Vendor Page Anti DACT2 pAb (ATL-HPA030251) at Atlas Antibodies

Documents & Links for Anti DACT2 pAb (ATL-HPA030251)
Datasheet Anti DACT2 pAb (ATL-HPA030251) Datasheet (External Link)
Vendor Page Anti DACT2 pAb (ATL-HPA030251)
Citations for Anti DACT2 pAb (ATL-HPA030251) – 1 Found
Yi, Zhen; Ouyang, Jiamin; Sun, Wenmin; Li, Shiqiang; Xiao, Xueshan; Zhang, Qingjiong. Comparative exome sequencing reveals novel candidate genes for retinitis pigmentosa. Ebiomedicine. 2020;56( 32454406):102792.  PubMed