Anti DACT1 pAb (ATL-HPA003016)

Atlas Antibodies

SKU:
ATL-HPA003016-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dishevelled-binding antagonist of beta-catenin 1
Gene Name: DACT1
Alternative Gene Name: DAPPER, DAPPER1, FRODO, HDPR1, THYEX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044548: 95%, ENSRNOG00000008445: 93%
Entrez Gene ID: 51339
Uniprot ID: Q9NYF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPLPYASPYAYVASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGS
Gene Sequence VPLPYASPYAYVASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGS
Gene ID - Mouse ENSMUSG00000044548
Gene ID - Rat ENSRNOG00000008445
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DACT1 pAb (ATL-HPA003016)
Datasheet Anti DACT1 pAb (ATL-HPA003016) Datasheet (External Link)
Vendor Page Anti DACT1 pAb (ATL-HPA003016) at Atlas Antibodies

Documents & Links for Anti DACT1 pAb (ATL-HPA003016)
Datasheet Anti DACT1 pAb (ATL-HPA003016) Datasheet (External Link)
Vendor Page Anti DACT1 pAb (ATL-HPA003016)