Anti DACH2 pAb (ATL-HPA000258)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000258-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DACH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025592: 95%, ENSRNOG00000004869: 59%
Entrez Gene ID: 117154
Uniprot ID: Q96NX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLPFMMMPHPLLPVSLPPASV |
| Gene Sequence | ITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLPFMMMPHPLLPVSLPPASV |
| Gene ID - Mouse | ENSMUSG00000025592 |
| Gene ID - Rat | ENSRNOG00000004869 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DACH2 pAb (ATL-HPA000258) | |
| Datasheet | Anti DACH2 pAb (ATL-HPA000258) Datasheet (External Link) |
| Vendor Page | Anti DACH2 pAb (ATL-HPA000258) at Atlas Antibodies |
| Documents & Links for Anti DACH2 pAb (ATL-HPA000258) | |
| Datasheet | Anti DACH2 pAb (ATL-HPA000258) Datasheet (External Link) |
| Vendor Page | Anti DACH2 pAb (ATL-HPA000258) |
| Citations for Anti DACH2 pAb (ATL-HPA000258) – 1 Found |
| Nodin, Björn; Fridberg, Marie; Uhlén, Mathias; Jirström, Karin. Discovery of dachshund 2 protein as a novel biomarker of poor prognosis in epithelial ovarian cancer. Journal Of Ovarian Research. 2012;5(1):6. PubMed |