Anti DACH2 pAb (ATL-HPA000258)

Atlas Antibodies

Catalog No.: ATL-HPA000258-25

Protein Description: dachshund family transcription factor 2
Gene Name: DACH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025592: 95%, ENSRNOG00000004869: 59%
Entrez Gene ID: 117154
Uniprot ID: Q96NX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLPFMMMPHPLLPVSLPPASV
• Gene Sequence: ITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLPFMMMPHPLLPVSLPPASV
• Gene ID - Mouse: ENSMUSG00000025592
• Gene ID - Rat: ENSRNOG00000004869
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DACH2 pAb (ATL-HPA000258) – 1 Found

Nodin, Björn; Fridberg, Marie; Uhlén, Mathias; Jirström, Karin. Discovery of dachshund 2 protein as a novel biomarker of poor prognosis in epithelial ovarian cancer. Journal Of Ovarian Research. 2012;5(1):6.