Anti DACH1 pAb (ATL-HPA012672)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012672-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: DACH1
Alternative Gene Name: DACH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055639: 91%, ENSRNOG00000008834: 88%
Entrez Gene ID: 1602
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP |
| Gene Sequence | PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP |
| Gene ID - Mouse | ENSMUSG00000055639 |
| Gene ID - Rat | ENSRNOG00000008834 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DACH1 pAb (ATL-HPA012672) | |
| Datasheet | Anti DACH1 pAb (ATL-HPA012672) Datasheet (External Link) |
| Vendor Page | Anti DACH1 pAb (ATL-HPA012672) at Atlas Antibodies |
| Documents & Links for Anti DACH1 pAb (ATL-HPA012672) | |
| Datasheet | Anti DACH1 pAb (ATL-HPA012672) Datasheet (External Link) |
| Vendor Page | Anti DACH1 pAb (ATL-HPA012672) |
| Citations for Anti DACH1 pAb (ATL-HPA012672) – 7 Found |
| Cao, Aili; Li, Jianhua; Asadi, Morad; Basgen, John M; Zhu, Bingbing; Yi, Zhengzi; Jiang, Song; Doke, Tomohito; El Shamy, Osama; Patel, Niralee; Cravedi, Paolo; Azeloglu, Evren U; Campbell, Kirk N; Menon, Madhav; Coca, Steve; Zhang, Weijia; Wang, Hao; Zen, Ke; Liu, Zhihong; Murphy, Barbara; He, John C; D'Agati, Vivette D; Susztak, Katalin; Kaufman, Lewis. DACH1 protects podocytes from experimental diabetic injury and modulates PTIP-H3K4Me3 activity. The Journal Of Clinical Investigation. 2021;131(10) PubMed |
| Powe, Desmond G; Dhondalay, Gopal Krishna R; Lemetre, Christophe; Allen, Tony; Habashy, Hany O; Ellis, Ian O; Rees, Robert; Ball, Graham R. DACH1: its role as a classifier of long term good prognosis in luminal breast cancer. Plos One. 9(1):e84428. PubMed |
| Vonlanthen, Janine; Okoniewski, Michal J; Menigatti, Mirco; Cattaneo, Elisa; Pellegrini-Ochsner, Daniela; Haider, Ritva; Jiricny, Josef; Staiano, Teresa; Buffoli, Federico; Marra, Giancarlo. A comprehensive look at transcription factor gene expression changes in colorectal adenomas. Bmc Cancer. 2014;14( 24472434):46. PubMed |
| Zhou, Junhua; Shaikh, Lalarukh Haris; Neogi, Sudeshna G; McFarlane, Ian; Zhao, Wanfeng; Figg, Nichola; Brighton, Cheryl A; Maniero, Carmela; Teo, Ada E D; Azizan, Elena A B; Brown, Morris J. DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-β signaling and suppresses aldosterone secretion. Hypertension (Dallas, Tex. : 1979). 2015;65(5):1103-10. PubMed |
| Endlich, Nicole; Kliewe, Felix; Kindt, Frances; Schmidt, Katharina; Kotb, Ahmed M; Artelt, Nadine; Lindenmeyer, Maja T; Cohen, Clemens D; Döring, Franziska; Kuss, Andreas W; Amann, Kerstin; Moeller, Marcus J; Kabgani, Nazanin; Blumenthal, Antje; Endlich, Karlhans. The transcription factor Dach1 is essential for podocyte function. Journal Of Cellular And Molecular Medicine. 2018;22(5):2656-2669. PubMed |
| Miesen, Laura; Eymael, Jennifer; Sharma, Shagun; Loeven, Markus A; Willemsen, Brigith; Bakker-van Bebber, Marinka; Mooren, Fieke; Meyer-Schwesinger, Catherine; Dijkman, Henry; Wetzels, Jack F M; Jansen, Jitske; van der Vlag, Johan; Smeets, Bart. Inhibition of mTOR delayed but could not prevent experimental collapsing focal segmental glomerulosclerosis. Scientific Reports. 2020;10(1):8580. PubMed |
| Zimmermann, Marina; Klaus, Martin; Wong, Milagros N; Thebille, Ann-Katrin; Gernhold, Lukas; Kuppe, Christoph; Halder, Maurice; Kranz, Jennifer; Wanner, Nicola; Braun, Fabian; Wulf, Sonia; Wiech, Thorsten; Panzer, Ulf; Krebs, Christian F; Hoxha, Elion; Kramann, Rafael; Huber, Tobias B; Bonn, Stefan; Puelles, Victor G. Deep learning-based molecular morphometrics for kidney biopsies. Jci Insight. 2021;6(7) PubMed |