Anti DACH1 pAb (ATL-HPA012672)

Atlas Antibodies

Catalog No.:
ATL-HPA012672-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: dachshund family transcription factor 1
Gene Name: DACH1
Alternative Gene Name: DACH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055639: 91%, ENSRNOG00000008834: 88%
Entrez Gene ID: 1602
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP
Gene Sequence PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP
Gene ID - Mouse ENSMUSG00000055639
Gene ID - Rat ENSRNOG00000008834
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DACH1 pAb (ATL-HPA012672)
Datasheet Anti DACH1 pAb (ATL-HPA012672) Datasheet (External Link)
Vendor Page Anti DACH1 pAb (ATL-HPA012672) at Atlas Antibodies

Documents & Links for Anti DACH1 pAb (ATL-HPA012672)
Datasheet Anti DACH1 pAb (ATL-HPA012672) Datasheet (External Link)
Vendor Page Anti DACH1 pAb (ATL-HPA012672)
Citations for Anti DACH1 pAb (ATL-HPA012672) – 7 Found
Cao, Aili; Li, Jianhua; Asadi, Morad; Basgen, John M; Zhu, Bingbing; Yi, Zhengzi; Jiang, Song; Doke, Tomohito; El Shamy, Osama; Patel, Niralee; Cravedi, Paolo; Azeloglu, Evren U; Campbell, Kirk N; Menon, Madhav; Coca, Steve; Zhang, Weijia; Wang, Hao; Zen, Ke; Liu, Zhihong; Murphy, Barbara; He, John C; D'Agati, Vivette D; Susztak, Katalin; Kaufman, Lewis. DACH1 protects podocytes from experimental diabetic injury and modulates PTIP-H3K4Me3 activity. The Journal Of Clinical Investigation. 2021;131(10)  PubMed
Powe, Desmond G; Dhondalay, Gopal Krishna R; Lemetre, Christophe; Allen, Tony; Habashy, Hany O; Ellis, Ian O; Rees, Robert; Ball, Graham R. DACH1: its role as a classifier of long term good prognosis in luminal breast cancer. Plos One. 9(1):e84428.  PubMed
Vonlanthen, Janine; Okoniewski, Michal J; Menigatti, Mirco; Cattaneo, Elisa; Pellegrini-Ochsner, Daniela; Haider, Ritva; Jiricny, Josef; Staiano, Teresa; Buffoli, Federico; Marra, Giancarlo. A comprehensive look at transcription factor gene expression changes in colorectal adenomas. Bmc Cancer. 2014;14( 24472434):46.  PubMed
Zhou, Junhua; Shaikh, Lalarukh Haris; Neogi, Sudeshna G; McFarlane, Ian; Zhao, Wanfeng; Figg, Nichola; Brighton, Cheryl A; Maniero, Carmela; Teo, Ada E D; Azizan, Elena A B; Brown, Morris J. DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-β signaling and suppresses aldosterone secretion. Hypertension (Dallas, Tex. : 1979). 2015;65(5):1103-10.  PubMed
Endlich, Nicole; Kliewe, Felix; Kindt, Frances; Schmidt, Katharina; Kotb, Ahmed M; Artelt, Nadine; Lindenmeyer, Maja T; Cohen, Clemens D; Döring, Franziska; Kuss, Andreas W; Amann, Kerstin; Moeller, Marcus J; Kabgani, Nazanin; Blumenthal, Antje; Endlich, Karlhans. The transcription factor Dach1 is essential for podocyte function. Journal Of Cellular And Molecular Medicine. 2018;22(5):2656-2669.  PubMed
Miesen, Laura; Eymael, Jennifer; Sharma, Shagun; Loeven, Markus A; Willemsen, Brigith; Bakker-van Bebber, Marinka; Mooren, Fieke; Meyer-Schwesinger, Catherine; Dijkman, Henry; Wetzels, Jack F M; Jansen, Jitske; van der Vlag, Johan; Smeets, Bart. Inhibition of mTOR delayed but could not prevent experimental collapsing focal segmental glomerulosclerosis. Scientific Reports. 2020;10(1):8580.  PubMed
Zimmermann, Marina; Klaus, Martin; Wong, Milagros N; Thebille, Ann-Katrin; Gernhold, Lukas; Kuppe, Christoph; Halder, Maurice; Kranz, Jennifer; Wanner, Nicola; Braun, Fabian; Wulf, Sonia; Wiech, Thorsten; Panzer, Ulf; Krebs, Christian F; Hoxha, Elion; Kramann, Rafael; Huber, Tobias B; Bonn, Stefan; Puelles, Victor G. Deep learning-based molecular morphometrics for kidney biopsies. Jci Insight. 2021;6(7)  PubMed