Anti DAB1 pAb (ATL-HPA067495)

Atlas Antibodies

Catalog No.:
ATL-HPA067495-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Dab, reelin signal transducer, homolog 1 (Drosophila)
Gene Name: DAB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028519: 100%, ENSRNOG00000007410: 100%
Entrez Gene ID: 1600
Uniprot ID: O75553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKL
Gene Sequence MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKL
Gene ID - Mouse ENSMUSG00000028519
Gene ID - Rat ENSRNOG00000007410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DAB1 pAb (ATL-HPA067495)
Datasheet Anti DAB1 pAb (ATL-HPA067495) Datasheet (External Link)
Vendor Page Anti DAB1 pAb (ATL-HPA067495) at Atlas Antibodies

Documents & Links for Anti DAB1 pAb (ATL-HPA067495)
Datasheet Anti DAB1 pAb (ATL-HPA067495) Datasheet (External Link)
Vendor Page Anti DAB1 pAb (ATL-HPA067495)