Anti DAAM2 pAb (ATL-HPA054630)

Atlas Antibodies

SKU: ATL-HPA054630-25

• 
• 

Protein Description: dishevelled associated activator of morphogenesis 2
Gene Name: DAAM2
Alternative Gene Name: KIAA0381
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040260: 84%, ENSRNOG00000053945: 82%
Entrez Gene ID: 23500
Uniprot ID: Q86T65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDEL
• Gene Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDEL
• Gene ID - Mouse: ENSMUSG00000040260
• Gene ID - Rat: ENSRNOG00000053945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.