Anti DAAM1 pAb (ATL-HPA026605)

Atlas Antibodies

Catalog No.: ATL-HPA026605-25

Protein Description: dishevelled associated activator of morphogenesis 1
Gene Name: DAAM1
Alternative Gene Name: KIAA0666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034574: 97%, ENSRNOG00000004345: 91%
Entrez Gene ID: 23002
Uniprot ID: Q9Y4D1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPG
• Gene Sequence: QNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPG
• Gene ID - Mouse: ENSMUSG00000034574
• Gene ID - Rat: ENSRNOG00000004345
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DAAM1 pAb (ATL-HPA026605) – 2 Found

Fenix, Aidan M; Neininger, Abigail C; Taneja, Nilay; Hyde, Karren; Visetsouk, Mike R; Garde, Ryan J; Liu, Baohong; Nixon, Benjamin R; Manalo, Annabelle E; Becker, Jason R; Crawley, Scott W; Bader, David M; Tyska, Matthew J; Liu, Qi; Gutzman, Jennifer H; Burnette, Dylan T. Muscle-specific stress fibers give rise to sarcomeres in cardiomyocytes. Elife. 2018;7( 30540249) 

Venditti, Massimo; Arcaniolo, Davide; De Sio, Marco; Minucci, Sergio. Preliminary Investigation on the Involvement of Cytoskeleton-Related Proteins, DAAM1 and PREP, in Human Testicular Disorders. International Journal Of Molecular Sciences. 2021;22(15)