Anti CYTH4 pAb (ATL-HPA071573)

Atlas Antibodies

Catalog No.:
ATL-HPA071573-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cytohesin 4
Gene Name: CYTH4
Alternative Gene Name: CYT4, cytohesin-4, PSCD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018008: 83%, ENSRNOG00000007679: 81%
Entrez Gene ID: 27128
Uniprot ID: Q9UIA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL
Gene Sequence MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL
Gene ID - Mouse ENSMUSG00000018008
Gene ID - Rat ENSRNOG00000007679
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYTH4 pAb (ATL-HPA071573)
Datasheet Anti CYTH4 pAb (ATL-HPA071573) Datasheet (External Link)
Vendor Page Anti CYTH4 pAb (ATL-HPA071573) at Atlas Antibodies

Documents & Links for Anti CYTH4 pAb (ATL-HPA071573)
Datasheet Anti CYTH4 pAb (ATL-HPA071573) Datasheet (External Link)
Vendor Page Anti CYTH4 pAb (ATL-HPA071573)