Anti CYTH4 pAb (ATL-HPA071573)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071573-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CYTH4
Alternative Gene Name: CYT4, cytohesin-4, PSCD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018008: 83%, ENSRNOG00000007679: 81%
Entrez Gene ID: 27128
Uniprot ID: Q9UIA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL |
| Gene Sequence | MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL |
| Gene ID - Mouse | ENSMUSG00000018008 |
| Gene ID - Rat | ENSRNOG00000007679 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYTH4 pAb (ATL-HPA071573) | |
| Datasheet | Anti CYTH4 pAb (ATL-HPA071573) Datasheet (External Link) |
| Vendor Page | Anti CYTH4 pAb (ATL-HPA071573) at Atlas Antibodies |
| Documents & Links for Anti CYTH4 pAb (ATL-HPA071573) | |
| Datasheet | Anti CYTH4 pAb (ATL-HPA071573) Datasheet (External Link) |
| Vendor Page | Anti CYTH4 pAb (ATL-HPA071573) |