Anti CYTH3 pAb (ATL-HPA013979)

Atlas Antibodies

SKU: ATL-HPA013979-25

• 
• 

Protein Description: cytohesin 3
Gene Name: CYTH3
Alternative Gene Name: ARNO3, cytohesin-3, GRP1, PSCD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018001: 97%, ENSRNOG00000001065: 86%
Entrez Gene ID: 9265
Uniprot ID: O43739
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM
• Gene Sequence: DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM
• Gene ID - Mouse: ENSMUSG00000018001
• Gene ID - Rat: ENSRNOG00000001065
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.