Anti CYTH3 pAb (ATL-HPA013979)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013979-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CYTH3
Alternative Gene Name: ARNO3, cytohesin-3, GRP1, PSCD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018001: 97%, ENSRNOG00000001065: 86%
Entrez Gene ID: 9265
Uniprot ID: O43739
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM |
| Gene Sequence | DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM |
| Gene ID - Mouse | ENSMUSG00000018001 |
| Gene ID - Rat | ENSRNOG00000001065 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYTH3 pAb (ATL-HPA013979) | |
| Datasheet | Anti CYTH3 pAb (ATL-HPA013979) Datasheet (External Link) |
| Vendor Page | Anti CYTH3 pAb (ATL-HPA013979) at Atlas Antibodies |
| Documents & Links for Anti CYTH3 pAb (ATL-HPA013979) | |
| Datasheet | Anti CYTH3 pAb (ATL-HPA013979) Datasheet (External Link) |
| Vendor Page | Anti CYTH3 pAb (ATL-HPA013979) |