Anti CYTH2 pAb (ATL-HPA060662)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060662-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CYTH2
Alternative Gene Name: ARNO, CTS18.1, cytohesin-2, PSCD2, PSCD2L, Sec7p-L, Sec7p-like
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003269: 100%, ENSRNOG00000021051: 100%
Entrez Gene ID: 9266
Uniprot ID: Q99418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF |
| Gene Sequence | REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF |
| Gene ID - Mouse | ENSMUSG00000003269 |
| Gene ID - Rat | ENSRNOG00000021051 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYTH2 pAb (ATL-HPA060662) | |
| Datasheet | Anti CYTH2 pAb (ATL-HPA060662) Datasheet (External Link) |
| Vendor Page | Anti CYTH2 pAb (ATL-HPA060662) at Atlas Antibodies |
| Documents & Links for Anti CYTH2 pAb (ATL-HPA060662) | |
| Datasheet | Anti CYTH2 pAb (ATL-HPA060662) Datasheet (External Link) |
| Vendor Page | Anti CYTH2 pAb (ATL-HPA060662) |