Anti CYTH2 pAb (ATL-HPA060662)

Atlas Antibodies

Catalog No.:
ATL-HPA060662-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cytohesin 2
Gene Name: CYTH2
Alternative Gene Name: ARNO, CTS18.1, cytohesin-2, PSCD2, PSCD2L, Sec7p-L, Sec7p-like
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003269: 100%, ENSRNOG00000021051: 100%
Entrez Gene ID: 9266
Uniprot ID: Q99418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF
Gene Sequence REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF
Gene ID - Mouse ENSMUSG00000003269
Gene ID - Rat ENSRNOG00000021051
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYTH2 pAb (ATL-HPA060662)
Datasheet Anti CYTH2 pAb (ATL-HPA060662) Datasheet (External Link)
Vendor Page Anti CYTH2 pAb (ATL-HPA060662) at Atlas Antibodies

Documents & Links for Anti CYTH2 pAb (ATL-HPA060662)
Datasheet Anti CYTH2 pAb (ATL-HPA060662) Datasheet (External Link)
Vendor Page Anti CYTH2 pAb (ATL-HPA060662)