Anti CYSRT1 pAb (ATL-HPA021886 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021886-100

Protein Description: cysteine-rich tail protein 1
Gene Name: CYSRT1
Alternative Gene Name: C9orf169, MGC59937
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036731: 75%, ENSRNOG00000010600: 78%
Entrez Gene ID: 375791
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
• Gene Sequence: PIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
• Gene ID - Mouse: ENSMUSG00000036731
• Gene ID - Rat: ENSRNOG00000010600
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.