Anti CYSRT1 pAb (ATL-HPA021886 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021886-100
  • Immunohistochemical staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles & vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CYSRT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404713).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cysteine-rich tail protein 1
Gene Name: CYSRT1
Alternative Gene Name: C9orf169, MGC59937
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036731: 75%, ENSRNOG00000010600: 78%
Entrez Gene ID: 375791
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
Gene Sequence PIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
Gene ID - Mouse ENSMUSG00000036731
Gene ID - Rat ENSRNOG00000010600
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CYSRT1 pAb (ATL-HPA021886 w/enhanced validation)
Datasheet Anti CYSRT1 pAb (ATL-HPA021886 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYSRT1 pAb (ATL-HPA021886 w/enhanced validation)