Anti CYSRT1 pAb (ATL-HPA021883)

Atlas Antibodies

Catalog No.:
ATL-HPA021883-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cysteine-rich tail protein 1
Gene Name: CYSRT1
Alternative Gene Name: C9orf169, MGC59937
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036731: 76%, ENSRNOG00000010600: 68%
Entrez Gene ID: 375791
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKG
Gene Sequence QEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKG
Gene ID - Mouse ENSMUSG00000036731
Gene ID - Rat ENSRNOG00000010600
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYSRT1 pAb (ATL-HPA021883)
Datasheet Anti CYSRT1 pAb (ATL-HPA021883) Datasheet (External Link)
Vendor Page Anti CYSRT1 pAb (ATL-HPA021883) at Atlas Antibodies

Documents & Links for Anti CYSRT1 pAb (ATL-HPA021883)
Datasheet Anti CYSRT1 pAb (ATL-HPA021883) Datasheet (External Link)
Vendor Page Anti CYSRT1 pAb (ATL-HPA021883)