Anti CYSRT1 pAb (ATL-HPA021883)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021883-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CYSRT1
Alternative Gene Name: C9orf169, MGC59937
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036731: 76%, ENSRNOG00000010600: 68%
Entrez Gene ID: 375791
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKG |
| Gene Sequence | QEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKG |
| Gene ID - Mouse | ENSMUSG00000036731 |
| Gene ID - Rat | ENSRNOG00000010600 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYSRT1 pAb (ATL-HPA021883) | |
| Datasheet | Anti CYSRT1 pAb (ATL-HPA021883) Datasheet (External Link) |
| Vendor Page | Anti CYSRT1 pAb (ATL-HPA021883) at Atlas Antibodies |
| Documents & Links for Anti CYSRT1 pAb (ATL-HPA021883) | |
| Datasheet | Anti CYSRT1 pAb (ATL-HPA021883) Datasheet (External Link) |
| Vendor Page | Anti CYSRT1 pAb (ATL-HPA021883) |