Anti CYSLTR2 pAb (ATL-HPA046528)

Atlas Antibodies

Catalog No.:
ATL-HPA046528-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cysteinyl leukotriene receptor 2
Gene Name: CYSLTR2
Alternative Gene Name: CysLT(2), CYSLT2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000112743: 35%, ENSRNOG00000012495: 37%
Entrez Gene ID: 57105
Uniprot ID: Q9NS75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE
Gene Sequence KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE
Gene ID - Mouse ENSMUSG00000112743
Gene ID - Rat ENSRNOG00000012495
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYSLTR2 pAb (ATL-HPA046528)
Datasheet Anti CYSLTR2 pAb (ATL-HPA046528) Datasheet (External Link)
Vendor Page Anti CYSLTR2 pAb (ATL-HPA046528) at Atlas Antibodies

Documents & Links for Anti CYSLTR2 pAb (ATL-HPA046528)
Datasheet Anti CYSLTR2 pAb (ATL-HPA046528) Datasheet (External Link)
Vendor Page Anti CYSLTR2 pAb (ATL-HPA046528)