Anti CYSLTR2 pAb (ATL-HPA046528)

Atlas Antibodies

Catalog No.: ATL-HPA046528-25

Protein Description: cysteinyl leukotriene receptor 2
Gene Name: CYSLTR2
Alternative Gene Name: CysLT(2), CYSLT2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000112743: 35%, ENSRNOG00000012495: 37%
Entrez Gene ID: 57105
Uniprot ID: Q9NS75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE
• Gene Sequence: KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE
• Gene ID - Mouse: ENSMUSG00000112743
• Gene ID - Rat: ENSRNOG00000012495
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.