Anti CYP7B1 pAb (ATL-HPA017761)

Atlas Antibodies

SKU:
ATL-HPA017761-25
  • Immunohistochemical staining of human small intestine shows strong membranous, and cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 7, subfamily B, polypeptide 1
Gene Name: CYP7B1
Alternative Gene Name: SPG5A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039519: 70%, ENSRNOG00000009730: 69%
Entrez Gene ID: 9420
Uniprot ID: O75881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLESSIFEALRLSSYSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIEDGKKKTTFFKRGKKLKCYLMPFGTGTSKC
Gene Sequence VRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLESSIFEALRLSSYSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIEDGKKKTTFFKRGKKLKCYLMPFGTGTSKC
Gene ID - Mouse ENSMUSG00000039519
Gene ID - Rat ENSRNOG00000009730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CYP7B1 pAb (ATL-HPA017761)
Datasheet Anti CYP7B1 pAb (ATL-HPA017761) Datasheet (External Link)
Vendor Page Anti CYP7B1 pAb (ATL-HPA017761) at Atlas Antibodies

Documents & Links for Anti CYP7B1 pAb (ATL-HPA017761)
Datasheet Anti CYP7B1 pAb (ATL-HPA017761) Datasheet (External Link)
Vendor Page Anti CYP7B1 pAb (ATL-HPA017761)