Anti CYP51A1 pAb (ATL-HPA043508 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA043508-25
  • Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-CYP51A1 antibody HPA043508 (A) shows similar protein distribution across tissues to independent antibody HPA041325 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 51, subfamily A, polypeptide 1
Gene Name: CYP51A1
Alternative Gene Name: CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001467: 93%, ENSRNOG00000007234: 95%
Entrez Gene ID: 1595
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKML
Gene Sequence AIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKML
Gene ID - Mouse ENSMUSG00000001467
Gene ID - Rat ENSRNOG00000007234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CYP51A1 pAb (ATL-HPA043508 w/enhanced validation)
Datasheet Anti CYP51A1 pAb (ATL-HPA043508 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP51A1 pAb (ATL-HPA043508 w/enhanced validation)