Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041325-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 51, subfamily A, polypeptide 1
Gene Name: CYP51A1
Alternative Gene Name: CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001467: 88%, ENSRNOG00000007234: 92%
Entrez Gene ID: 1595
Uniprot ID: Q16850
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQH
Gene Sequence RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQH
Gene ID - Mouse ENSMUSG00000001467
Gene ID - Rat ENSRNOG00000007234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation)
Datasheet Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation)
Datasheet Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation)
Citations for Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) – 1 Found
Howell, Mark C; Green, Ryan; Khalil, Roukiah; Foran, Elspeth; Quarni, Waise; Nair, Rajesh; Stevens, Stanley; Grinchuk, Aleksandr; Hanna, Andrew; Mohapatra, Shyam; Mohapatra, Subhra. Lung cancer cells survive epidermal growth factor receptor tyrosine kinase inhibitor exposure through upregulation of cholesterol synthesis. Faseb Bioadvances. 2020;2(2):90-105.  PubMed