Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041325-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CYP51A1
Alternative Gene Name: CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001467: 88%, ENSRNOG00000007234: 92%
Entrez Gene ID: 1595
Uniprot ID: Q16850
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQH |
| Gene Sequence | RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQH |
| Gene ID - Mouse | ENSMUSG00000001467 |
| Gene ID - Rat | ENSRNOG00000007234 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) | |
| Datasheet | Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) | |
| Datasheet | Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) |
| Citations for Anti CYP51A1 pAb (ATL-HPA041325 w/enhanced validation) – 1 Found |
| Howell, Mark C; Green, Ryan; Khalil, Roukiah; Foran, Elspeth; Quarni, Waise; Nair, Rajesh; Stevens, Stanley; Grinchuk, Aleksandr; Hanna, Andrew; Mohapatra, Shyam; Mohapatra, Subhra. Lung cancer cells survive epidermal growth factor receptor tyrosine kinase inhibitor exposure through upregulation of cholesterol synthesis. Faseb Bioadvances. 2020;2(2):90-105. PubMed |