Anti CYP4F2 pAb (ATL-HPA014048)

Atlas Antibodies

Catalog No.: ATL-HPA014048-25

Protein Description: cytochrome P450, family 4, subfamily F, polypeptide 2
Gene Name: CYP4F2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090700: 68%, ENSRNOG00000043344: 70%
Entrez Gene ID: 8529
Uniprot ID: P78329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD
• Gene Sequence: RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD
• Gene ID - Mouse: ENSMUSG00000090700
• Gene ID - Rat: ENSRNOG00000043344
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CYP4F2 pAb (ATL-HPA014048) – 2 Found

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Alexanian, Anna; Miller, Bradley; Roman, Richard J; Sorokin, Andrey. 20-HETE-producing enzymes are up-regulated in human cancers. Cancer Genomics & Proteomics. 2012;9(4):163-9.