Anti CYP4F11 pAb (ATL-HPA017265)

Atlas Antibodies

Catalog No.:
ATL-HPA017265-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 4, subfamily F, polypeptide 11
Gene Name: CYP4F11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090700: 76%, ENSRNOG00000043344: 74%
Entrez Gene ID: 57834
Uniprot ID: Q9HBI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAF
Gene Sequence YDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAF
Gene ID - Mouse ENSMUSG00000090700
Gene ID - Rat ENSRNOG00000043344
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP4F11 pAb (ATL-HPA017265)
Datasheet Anti CYP4F11 pAb (ATL-HPA017265) Datasheet (External Link)
Vendor Page Anti CYP4F11 pAb (ATL-HPA017265) at Atlas Antibodies

Documents & Links for Anti CYP4F11 pAb (ATL-HPA017265)
Datasheet Anti CYP4F11 pAb (ATL-HPA017265) Datasheet (External Link)
Vendor Page Anti CYP4F11 pAb (ATL-HPA017265)