Anti CYP4F11 pAb (ATL-HPA017265)

Atlas Antibodies

SKU: ATL-HPA017265-100

• 
• 

Protein Description: cytochrome P450, family 4, subfamily F, polypeptide 11
Gene Name: CYP4F11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090700: 76%, ENSRNOG00000043344: 74%
Entrez Gene ID: 57834
Uniprot ID: Q9HBI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAF
• Gene Sequence: YDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAF
• Gene ID - Mouse: ENSMUSG00000090700
• Gene ID - Rat: ENSRNOG00000043344
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.