Anti CYP2W1 pAb (ATL-HPA012753)

Atlas Antibodies

Catalog No.: ATL-HPA012753-25

Protein Description: cytochrome P450, family 2, subfamily W, polypeptide 1
Gene Name: CYP2W1
Alternative Gene Name: FLJ20359, MGC34287
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029541: 75%, ENSRNOG00000051770: 73%
Entrez Gene ID: 54905
Uniprot ID: Q8TAV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLG
• Gene Sequence: VLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLG
• Gene ID - Mouse: ENSMUSG00000029541
• Gene ID - Rat: ENSRNOG00000051770
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.