Anti CYP2W1 pAb (ATL-HPA012753)

Atlas Antibodies

Catalog No.:
ATL-HPA012753-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 2, subfamily W, polypeptide 1
Gene Name: CYP2W1
Alternative Gene Name: FLJ20359, MGC34287
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029541: 75%, ENSRNOG00000051770: 73%
Entrez Gene ID: 54905
Uniprot ID: Q8TAV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLG
Gene Sequence VLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLG
Gene ID - Mouse ENSMUSG00000029541
Gene ID - Rat ENSRNOG00000051770
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP2W1 pAb (ATL-HPA012753)
Datasheet Anti CYP2W1 pAb (ATL-HPA012753) Datasheet (External Link)
Vendor Page Anti CYP2W1 pAb (ATL-HPA012753) at Atlas Antibodies

Documents & Links for Anti CYP2W1 pAb (ATL-HPA012753)
Datasheet Anti CYP2W1 pAb (ATL-HPA012753) Datasheet (External Link)
Vendor Page Anti CYP2W1 pAb (ATL-HPA012753)