Anti CYP2U1 pAb (ATL-HPA041622)

Atlas Antibodies

Catalog No.:
ATL-HPA041622-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 2, subfamily U, polypeptide 1
Gene Name: CYP2U1
Alternative Gene Name: SPG49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027983: 81%, ENSRNOG00000011053: 81%
Entrez Gene ID: 113612
Uniprot ID: Q7Z449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERK
Gene Sequence LPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERK
Gene ID - Mouse ENSMUSG00000027983
Gene ID - Rat ENSRNOG00000011053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP2U1 pAb (ATL-HPA041622)
Datasheet Anti CYP2U1 pAb (ATL-HPA041622) Datasheet (External Link)
Vendor Page Anti CYP2U1 pAb (ATL-HPA041622) at Atlas Antibodies

Documents & Links for Anti CYP2U1 pAb (ATL-HPA041622)
Datasheet Anti CYP2U1 pAb (ATL-HPA041622) Datasheet (External Link)
Vendor Page Anti CYP2U1 pAb (ATL-HPA041622)