Anti CYP2U1 pAb (ATL-HPA041622)

Atlas Antibodies

Catalog No.: ATL-HPA041622-25

Protein Description: cytochrome P450, family 2, subfamily U, polypeptide 1
Gene Name: CYP2U1
Alternative Gene Name: SPG49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027983: 81%, ENSRNOG00000011053: 81%
Entrez Gene ID: 113612
Uniprot ID: Q7Z449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERK
• Gene Sequence: LPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERK
• Gene ID - Mouse: ENSMUSG00000027983
• Gene ID - Rat: ENSRNOG00000011053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.