Anti CYP2S1 pAb (ATL-HPA049227)

Atlas Antibodies

Catalog No.:
ATL-HPA049227-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 2, subfamily S, polypeptide 1
Gene Name: CYP2S1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040703: 82%, ENSRNOG00000020743: 80%
Entrez Gene ID: 29785
Uniprot ID: Q96SQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL
Gene Sequence GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL
Gene ID - Mouse ENSMUSG00000040703
Gene ID - Rat ENSRNOG00000020743
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP2S1 pAb (ATL-HPA049227)
Datasheet Anti CYP2S1 pAb (ATL-HPA049227) Datasheet (External Link)
Vendor Page Anti CYP2S1 pAb (ATL-HPA049227) at Atlas Antibodies

Documents & Links for Anti CYP2S1 pAb (ATL-HPA049227)
Datasheet Anti CYP2S1 pAb (ATL-HPA049227) Datasheet (External Link)
Vendor Page Anti CYP2S1 pAb (ATL-HPA049227)