Anti CYP2E1 pAb (ATL-HPA009128 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009128-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CYP2E1
Alternative Gene Name: CYP2E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025479: 86%, ENSRNOG00000012458: 86%
Entrez Gene ID: 1571
Uniprot ID: P05181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAG |
| Gene Sequence | EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAG |
| Gene ID - Mouse | ENSMUSG00000025479 |
| Gene ID - Rat | ENSRNOG00000012458 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CYP2E1 pAb (ATL-HPA009128 w/enhanced validation) | |
| Datasheet | Anti CYP2E1 pAb (ATL-HPA009128 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYP2E1 pAb (ATL-HPA009128 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CYP2E1 pAb (ATL-HPA009128 w/enhanced validation) | |
| Datasheet | Anti CYP2E1 pAb (ATL-HPA009128 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYP2E1 pAb (ATL-HPA009128 w/enhanced validation) |
| Citations for Anti CYP2E1 pAb (ATL-HPA009128 w/enhanced validation) – 17 Found |
| Preziosi, Morgan; Poddar, Minakshi; Singh, Sucha; Monga, Satdarshan P. Hepatocyte Wnts Are Dispensable During Diethylnitrosamine and Carbon Tetrachloride-Induced Injury and Hepatocellular Cancer. Gene Expression. 2018;18(3):209-219. PubMed |
| Atarashi, Machi; Izawa, Takeshi; Mori, Mutsuki; Inai, Yohei; Kuwamura, Mitsuru; Yamate, Jyoji. Dietary Iron Overload Abrogates Chemically-Induced Liver Cirrhosis in Rats. Nutrients. 2018;10(10) PubMed |
| Hou, Wei; Bukong, Terence N; Kodys, Karen; Szabo, Gyongyi. Alcohol facilitates HCV RNA replication via up-regulation of miR-122 expression and inhibition of cyclin G1 in human hepatoma cells. Alcoholism, Clinical And Experimental Research. 2013;37(4):599-608. PubMed |
| AlWahsh, Mohammad; Othman, Amnah; Hamadneh, Lama; Telfah, Ahmad; Lambert, Jörg; Hikmat, Suhair; Alassi, Amin; Mohamed, Fatma El Zahraa; Hergenröder, Roland; Al-Qirim, Tariq; Dooley, Steven; Hammad, Seddik. Second exposure to acetaminophen overdose is associated with liver fibrosis in mice. Excli Journal. 18( 30956639):51-62. PubMed |
| Dobie, Ross; Wilson-Kanamori, John R; Henderson, Beth E P; Smith, James R; Matchett, Kylie P; Portman, Jordan R; Wallenborg, Karolina; Picelli, Simone; Zagorska, Anna; Pendem, Swetha V; Hudson, Thomas E; Wu, Minnie M; Budas, Grant R; Breckenridge, David G; Harrison, Ewen M; Mole, Damian J; Wigmore, Stephen J; Ramachandran, Prakash; Ponting, Chris P; Teichmann, Sarah A; Marioni, John C; Henderson, Neil C. Single-Cell Transcriptomics Uncovers Zonation of Function in the Mesenchyme during Liver Fibrosis. Cell Reports. 2019;29(7):1832-1847.e8. PubMed |
| Ma, Xi; Zhou, Lin; Zheng, Shusen. Transcriptome analysis revealed key prognostic genes and microRNAs in hepatocellular carcinoma. Peerj. 8( 32296612):e8930. PubMed |
| Wang, Ting; Du, Huihui; Ma, Jingsong; Shen, Lu; Wei, Muyun; Zhao, Xianglong; Chen, Luan; Li, Mo; Li, Guorong; Xing, Qinghe; He, Lin; Qin, Shengying. Functional characterization of the chlorzoxazone 6-hydroxylation activity of human cytochrome P450 2E1 allelic variants in Han Chinese. Peerj. 8( 32821545):e9628. PubMed |
| Buler, Marcin; Naessens, Thomas; Mattsson, Johan; Morias, Yannick; Söderberg, Magnus; Robbins, Philip; Kärrberg, Lillevi; Svensson, Tor S; Thulin, Petra; Glinghammar, Björn; Scarpulla, Richard C; Andersson, Ulf. The regulatory role of PGC1α-related coactivator in response to drug-induced liver injury. Faseb Bioadvances. 2020;2(8):453-463. PubMed |
| Schuran, Fenja A; Lommetz, Christoph; Steudter, Andreas; Ghallab, Ahmed; Wieschendorf, Björn; Schwinge, Dorothee; Zuehlke, Sebastian; Reinders, Joerg; Heeren, Joerg; Lohse, Ansgar W; Schramm, Christoph; Herkel, Johannes; Carambia, Antonella. Aryl Hydrocarbon Receptor Activity in Hepatocytes Sensitizes to Hyperacute Acetaminophen-Induced Hepatotoxicity in Mice. Cellular And Molecular Gastroenterology And Hepatology. 11(2):371-388. PubMed |
| Schneider, Kai Markus; Elfers, Carsten; Ghallab, Ahmed; Schneider, Carolin Victoria; Galvez, Eric J C; Mohs, Antje; Gui, Wenfang; Candels, Lena Susanna; Wirtz, Theresa Hildegard; Zuehlke, Sebastian; Spiteller, Michael; Myllys, Maiju; Roulet, Alain; Ouzerdine, Amirouche; Lelouvier, Benjamin; Kilic, Konrad; Liao, Lijun; Nier, Anika; Latz, Eicke; Bergheim, Ina; Thaiss, Christoph A; Hengstler, Jan G; Strowig, Till; Trautwein, Christian. Intestinal Dysbiosis Amplifies Acetaminophen-Induced Acute Liver Injury. Cellular And Molecular Gastroenterology And Hepatology. 11(4):909-933. PubMed |
| Frenkel, Nicola C; Poghosyan, Susanna; Verheem, André; Padera, Timothy P; Rinkes, Inne H M Borel; Kranenburg, Onno; Hagendoorn, Jeroen. Liver lymphatic drainage patterns follow segmental anatomy in a murine model. Scientific Reports. 2020;10(1):21808. PubMed |
| Naim, Samara; Fernandez-Marrero, Yuniel; de Brot, Simone; Bachmann, Daniel; Kaufmann, Thomas. Loss of BOK Has a Minor Impact on Acetaminophen Overdose-Induced Liver Damage in Mice. International Journal Of Molecular Sciences. 2021;22(6) PubMed |
| Koch, Philipp-Sebastian; Sandorski, Kajetan; Heil, Joschka; Schmid, Christian D; Kürschner, Sina W; Hoffmann, Johannes; Winkler, Manuel; Staniczek, Theresa; de la Torre, Carolina; Sticht, Carsten; Schledzewski, Kai; Taketo, Makoto Mark; Trogisch, Felix A; Heineke, Joerg; Géraud, Cyrill; Goerdt, Sergij; Olsavszky, Victor. Imbalanced Activation of Wnt-/β-Catenin-Signaling in Liver Endothelium Alters Normal Sinusoidal Differentiation. Frontiers In Physiology. 12( 34658910):722394. PubMed |
| Zhu, Shichao; Rao, Xiyun; Qian, Yude; Chen, Jinbiao; Song, Renhua; Yan, Huili; Yang, Xi; Hu, Junhao; Wang, Xiaohong; Han, Zhiming; Zhu, Yi; Liu, Renjing; Jong-Leong Wong, Justin; McCaughan, Geoffrey W; Zheng, Xiangjian. Liver Endothelial Heg Regulates Vascular/Biliary Network Patterning and Metabolic Zonation Via Wnt Signaling. Cellular And Molecular Gastroenterology And Hepatology. 13(6):1757-1783. PubMed |
| Matsuoka, Yuta; Takahashi, Masatomo; Sugiura, Yuki; Izumi, Yoshihiro; Nishiyama, Kazuhiro; Nishida, Motohiro; Suematsu, Makoto; Bamba, Takeshi; Yamada, Ken-Ichi. Structural library and visualization of endogenously oxidized phosphatidylcholines using mass spectrometry-based techniques. Nature Communications. 2021;12(1):6339. PubMed |
| Hu, Shikai; Liu, Silvia; Bian, Yu; Poddar, Minakshi; Singh, Sucha; Cao, Catherine; McGaughey, Jackson; Bell, Aaron; Blazer, Levi L; Adams, Jarret J; Sidhu, Sachdev S; Angers, Stephane; Monga, Satdarshan P. Single-cell spatial transcriptomics reveals a dynamic control of metabolic zonation and liver regeneration by endothelial cell Wnt2 and Wnt9b. Cell Reports. Medicine. 2022;3(10):100754. PubMed |
| Albadry, Mohamed; Höpfl, Sebastian; Ehteshamzad, Nadia; König, Matthias; Böttcher, Michael; Neumann, Jasna; Lupp, Amelie; Dirsch, Olaf; Radde, Nicole; Christ, Bruno; Christ, Madlen; Schwen, Lars Ole; Laue, Hendrik; Klopfleisch, Robert; Dahmen, Uta. Periportal steatosis in mice affects distinct parameters of pericentral drug metabolism. Scientific Reports. 2022;12(1):21825. PubMed |