Anti CYP2C9 pAb (ATL-HPA015066)

Atlas Antibodies

Catalog No.:
ATL-HPA015066-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 2, subfamily C, polypeptide 9
Gene Name: CYP2C9
Alternative Gene Name: CYP2C10, P450IIC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067231: 79%, ENSRNOG00000052810: 75%
Entrez Gene ID: 1559
Uniprot ID: P11712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTST
Gene Sequence KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTST
Gene ID - Mouse ENSMUSG00000067231
Gene ID - Rat ENSRNOG00000052810
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP2C9 pAb (ATL-HPA015066)
Datasheet Anti CYP2C9 pAb (ATL-HPA015066) Datasheet (External Link)
Vendor Page Anti CYP2C9 pAb (ATL-HPA015066) at Atlas Antibodies

Documents & Links for Anti CYP2C9 pAb (ATL-HPA015066)
Datasheet Anti CYP2C9 pAb (ATL-HPA015066) Datasheet (External Link)
Vendor Page Anti CYP2C9 pAb (ATL-HPA015066)
Citations for Anti CYP2C9 pAb (ATL-HPA015066) – 2 Found
Ashida, Ryo; Okamura, Yukiyasu; Ohshima, Keiichi; Kakuda, Yuko; Uesaka, Katsuhiko; Sugiura, Teiichi; Ito, Takaaki; Yamamoto, Yusuke; Sugino, Takashi; Urakami, Kenichi; Kusuhara, Masatoshi; Yamaguchi, Ken. The down-regulation of the CYP2C19 gene is associated with aggressive tumor potential and the poorer recurrence-free survival of hepatocellular carcinoma. Oncotarget. 2018;9(31):22058-22068.  PubMed
Uehara, Shotaro; Iida, Yuichi; Ida-Tanaka, Miyuki; Goto, Motohito; Kawai, Kenji; Yamamoto, Masafumi; Higuchi, Yuichiro; Ito, Satoshi; Takahashi, Riichi; Kamimura, Hidetaka; Ito, Mamoru; Yamazaki, Hiroshi; Oshimura, Mitsuo; Kazuki, Yasuhiro; Suemizu, Hiroshi. Humanized liver TK-NOG mice with functional deletion of hepatic murine cytochrome P450s as a model for studying human drug metabolism. Scientific Reports. 2022;12(1):14907.  PubMed