Anti CYP2C8 pAb (ATL-HPA013547 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA013547-25
  • Immunohistochemistry analysis in human liver and skin tissues using HPA013547 antibody. Corresponding CYP2C8 RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-CYP2C8 antibody HPA013547 (A) shows similar pattern to independent antibody HPA013970 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 2, subfamily C, polypeptide 8
Gene Name: CYP2C8
Alternative Gene Name: CPC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067231: 75%, ENSRNOG00000046080: 75%
Entrez Gene ID: 1558
Uniprot ID: P10632
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV
Gene Sequence KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV
Gene ID - Mouse ENSMUSG00000067231
Gene ID - Rat ENSRNOG00000046080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CYP2C8 pAb (ATL-HPA013547 w/enhanced validation)
Datasheet Anti CYP2C8 pAb (ATL-HPA013547 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP2C8 pAb (ATL-HPA013547 w/enhanced validation)