Anti CYP2B6 pAb (ATL-HPA062973)

Atlas Antibodies

Catalog No.: ATL-HPA062973-25

Protein Description: cytochrome P450, family 2, subfamily B, polypeptide 6
Gene Name: CYP2B6
Alternative Gene Name: CPB6, CYP2B, CYPIIB6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030483: 82%, ENSRNOG00000033680: 82%
Entrez Gene ID: 1555
Uniprot ID: P20813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAQCLIEELRKSKGALVDPTFLFHSITANIICSI
• Gene Sequence: EAQCLIEELRKSKGALVDPTFLFHSITANIICSI
• Gene ID - Mouse: ENSMUSG00000030483
• Gene ID - Rat: ENSRNOG00000033680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.