Anti CYP2B6 pAb (ATL-HPA062973)

Atlas Antibodies

Catalog No.:
ATL-HPA062973-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 2, subfamily B, polypeptide 6
Gene Name: CYP2B6
Alternative Gene Name: CPB6, CYP2B, CYPIIB6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030483: 82%, ENSRNOG00000033680: 82%
Entrez Gene ID: 1555
Uniprot ID: P20813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAQCLIEELRKSKGALVDPTFLFHSITANIICSI
Gene Sequence EAQCLIEELRKSKGALVDPTFLFHSITANIICSI
Gene ID - Mouse ENSMUSG00000030483
Gene ID - Rat ENSRNOG00000033680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP2B6 pAb (ATL-HPA062973)
Datasheet Anti CYP2B6 pAb (ATL-HPA062973) Datasheet (External Link)
Vendor Page Anti CYP2B6 pAb (ATL-HPA062973) at Atlas Antibodies

Documents & Links for Anti CYP2B6 pAb (ATL-HPA062973)
Datasheet Anti CYP2B6 pAb (ATL-HPA062973) Datasheet (External Link)
Vendor Page Anti CYP2B6 pAb (ATL-HPA062973)