Anti CYP27C1 pAb (ATL-HPA068731)

Atlas Antibodies

Catalog No.:
ATL-HPA068731-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 27, subfamily C, polypeptide 1
Gene Name: CYP27C1
Alternative Gene Name: FLJ16008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026170: 48%, ENSRNOG00000017188: 48%
Entrez Gene ID: 339761
Uniprot ID: Q4G0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRS
Gene Sequence FPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRS
Gene ID - Mouse ENSMUSG00000026170
Gene ID - Rat ENSRNOG00000017188
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP27C1 pAb (ATL-HPA068731)
Datasheet Anti CYP27C1 pAb (ATL-HPA068731) Datasheet (External Link)
Vendor Page Anti CYP27C1 pAb (ATL-HPA068731) at Atlas Antibodies

Documents & Links for Anti CYP27C1 pAb (ATL-HPA068731)
Datasheet Anti CYP27C1 pAb (ATL-HPA068731) Datasheet (External Link)
Vendor Page Anti CYP27C1 pAb (ATL-HPA068731)