Anti CYP27C1 pAb (ATL-HPA062460)

Atlas Antibodies

SKU:
ATL-HPA062460-25
  • Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytochrome P450 family 27 subfamily C member 1
Gene Name: CYP27C1
Alternative Gene Name: FLJ16008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038567: 43%, ENSRNOG00000046214: 42%
Entrez Gene ID: 339761
Uniprot ID: Q4G0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLK
Gene Sequence TTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLK
Gene ID - Mouse ENSMUSG00000038567
Gene ID - Rat ENSRNOG00000046214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CYP27C1 pAb (ATL-HPA062460)
Datasheet Anti CYP27C1 pAb (ATL-HPA062460) Datasheet (External Link)
Vendor Page Anti CYP27C1 pAb (ATL-HPA062460) at Atlas Antibodies

Documents & Links for Anti CYP27C1 pAb (ATL-HPA062460)
Datasheet Anti CYP27C1 pAb (ATL-HPA062460) Datasheet (External Link)
Vendor Page Anti CYP27C1 pAb (ATL-HPA062460)