Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA059155-25
  • Immunohistochemistry analysis in human liver and pancreas tissues using HPA059155 antibody. Corresponding CYP27A1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 27, subfamily A, polypeptide 1
Gene Name: CYP27A1
Alternative Gene Name: CP27, CTX, CYP27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026170: 67%, ENSRNOG00000017188: 69%
Entrez Gene ID: 1593
Uniprot ID: Q02318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD
Gene Sequence RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD
Gene ID - Mouse ENSMUSG00000026170
Gene ID - Rat ENSRNOG00000017188
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation)
Datasheet Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation)