Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053371-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cytochrome P450, family 21, subfamily A, polypeptide 2
Gene Name: CYP21A2
Alternative Gene Name: CA21H, CAH1, CPS1, CYP21, CYP21B, P450c21B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024365: 73%, ENSRNOG00000000428: 72%
Entrez Gene ID: 1589
Uniprot ID: P08686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV
Gene Sequence LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV
Gene ID - Mouse ENSMUSG00000024365
Gene ID - Rat ENSRNOG00000000428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation)
Datasheet Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation)
Datasheet Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation)
Citations for Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) – 1 Found
Meimaridou, E; Goldsworthy, M; Chortis, V; Fragouli, E; Foster, P A; Arlt, W; Cox, R; Metherell, L A. NNT is a key regulator of adrenal redox homeostasis and steroidogenesis in male mice. The Journal Of Endocrinology. 2018;236(1):13-28.  PubMed