Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053371-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CYP21A2
Alternative Gene Name: CA21H, CAH1, CPS1, CYP21, CYP21B, P450c21B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024365: 73%, ENSRNOG00000000428: 72%
Entrez Gene ID: 1589
Uniprot ID: P08686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV |
Gene Sequence | LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV |
Gene ID - Mouse | ENSMUSG00000024365 |
Gene ID - Rat | ENSRNOG00000000428 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) | |
Datasheet | Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) | |
Datasheet | Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) |
Citations for Anti CYP21A2 pAb (ATL-HPA053371 w/enhanced validation) – 1 Found |
Meimaridou, E; Goldsworthy, M; Chortis, V; Fragouli, E; Foster, P A; Arlt, W; Cox, R; Metherell, L A. NNT is a key regulator of adrenal redox homeostasis and steroidogenesis in male mice. The Journal Of Endocrinology. 2018;236(1):13-28. PubMed |